StarFunc result for job id Q6BDS2

User Input

>input (1440 residues)
MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGQLTNLELDEEVLQNVLELPTWLAITR
VYCNRASIRIQWTKLKTHPICLCLDKVEVEMKTCEDPRPPNGQSPIALASGQSEYGFAEK
VVEGMFIIVNSITIKIHSKAFHASFELWQLQGYSVNPNWQQSDLRLTRITDPCRGEVLTF
KEITWQTLRIEADATDNGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVISSKLMFLLDD
LLWVLTDSQLKAMMKYAESLSEAMEKSAHQRKSLAPEPVQITPPAPSAQQSWAQAFGGSQ
GNSNSSSSRLSQYFEKFDVKESSYHLLISRLDLHICDDSQSREPGVSANRLMGGAMQLTF
RKMAFDYYPFHWAGDSCKHWVRHCEAMETRGQWAQKLVMEFQSKMEKWHEETGLKPPWHL
GVDSLFRRKADSLSSPRKNPLERSPSQGRQPAFQPPAWNRLRSSCMVVRVDDLDIHQVST
AGQPSKKPSTLLSCSRKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFT
MDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERA
ELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSL
LHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVA
PFPLSIWACLPLRWQQAQARKLLLASEGRLKPSASFGSPVQSEALAPDSMSHPRSKTEHD
LKSLSGLTEVMEILKEGSSGMDNKGPLTELEDVADVHMLVHSPAHVRVRLDHYQYLALLR
LKEVLQRLQEQLTKDTESMTGSPLQNQTACIGVLFPSAEVALLMHPAPGAVDADSAGSDS
TSLVDSELSPSEDRELKSDASSDQGPASPEKVLEESSIENQDVSQERPHSNGELQDSGPL
AQQLAGKGHEAVESLQAKKLSRTQASSSPAALKPPAGRETAVNGQGELIPLKNIEGELSS
AIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLPPAKEPMAKTDE
GVAAPVSGGAARLRFFSMKRTVSQQSFDGVSLDSSGPEDRISVDSDGSDSFVMLLESESG
PESVPPGSLSNVSDNAGVQGSPLVNNYGQGSPAANSSVSPSGEDLIFHPVSVLVLKVNEV
SFGIEVRGEDLTVALQAEELTLQQLGTVGLWQFLHGQCPGTCFQESSTLKTGHIRPAVGL
RFEVGPGAAVHSPLASQNGFLHLLLHGCDLELLTSVLSGLGPFLEDEEIPVVVPMQIELL
NSSITLKDDIPPIYPTSPGPIPITLAMEHVVLKRSDDGVFHIGAAAQDKPSAEVLKSEKR
QPPKEQVFLVPTGEVFEQQVKELPILQKELIETKQALANANQDKEKLLQEIRKYNPFFEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0JNW5	0.692	0.681	0.000	1464	0.424	0.417	A0JNW5.pdb.gz	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
2	AFDB:Q6BDS2	1.000	1.000	0.000	1440	1.000	1.000	Q6BDS2.pdb.gz	BLT3A_HUMAN Bridge-like lipid transfer protein family member 3A OS=Homo sapiens OX=9606 GN=BLTP3A PE=1 SV=1
3	AFDB:Q21480	0.367	0.246	3.566E-26	2290	0.110	0.069	Q21480.pdb.gz	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3
4	PDB:6a9eA	0.080	0.300	8.070E-5	339	0.018	0.077	6a9eA.pdb.gz
5	PDB:6g2iA	0.060	0.050	4.785E-4	2080	0.033	0.023	6g2iA.pdb.gz
6	PDB:6g2dC	0.061	0.050	1.197E-3	2121	0.035	0.024	6g2dC.pdb.gz
7	PDB:5cskB	0.055	0.046	2.414E-3	2017	0.028	0.020	5cskB.pdb.gz
8	PDB:5cslA	0.046	0.038	5.136E-3	2050	0.027	0.019	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
9	PDB:7n9sA	0.041	0.030	6.038E-3	2365	0.024	0.014	7n9sA.pdb.gz
10	AFDB:Q9VIX7	0.031	0.070	4.540E-2	577	0.051	0.127	Q9VIX7.pdb.gz	Q9VIX7_DROME Fondue, isoform B OS=Drosophila melanogaster OX=7227 GN=fon PE=1 SV=1
11	PDB:3h4zA	0.050	0.098	5.223E-2	568	0.013	0.033	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
12	PDB:6ht9B	0.034	0.090	9.454E-2	316	0.020	0.092	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.
13	PDB:7bk0B	0.036	0.112	1.173E-1	250	0.021	0.120	7bk0B.pdb.gz
14	PDB:6i7sG	0.033	0.050	1.379E-1	863	0.026	0.044	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
15	AFDB:Q8I5K3	0.038	0.026	2.692E-1	2329	0.062	0.039	Q8I5K3.pdb.gz	Q8I5K3_PLAF7 Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1221000 PE=4 SV=1
16	AFDB:G1SU30	0.037	0.043	3.721E-1	1162	0.062	0.077	G1SU30.pdb.gz	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2
17	AFDB:Q61191	0.031	0.025	4.375E-1	2045	0.055	0.039	Q61191.pdb.gz	HCFC1_MOUSE Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcfc1 PE=1 SV=2
18	AFDB:Q9V8R9	0.029	0.026	5.428E-1	1698	0.046	0.039	Q9V8R9.pdb.gz	EPB41_DROME Protein 4.1 homolog OS=Drosophila melanogaster OX=7227 GN=cora PE=1 SV=1
19	AFDB:Q382R7	0.038	0.049	7.109E-1	974	0.069	0.102	Q382R7.pdb.gz	Q382R7_TRYB2 PH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4480 PE=4 SV=1
20	AFDB:Q5U303	0.029	0.059	7.918E-1	693	0.047	0.097	Q5U303.pdb.gz	TAB2_RAT TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Tab2 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JNW5	0.0	1023	1464	0.438	0.430	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
2	Q6BDS2	0.0	2967	1440	1.000	1.000	BLT3A_HUMAN Bridge-like lipid transfer protein family member 3A OS=Homo sapiens OX=9606 GN=BLTP3A PE=1 SV=1
3	Q80TY5	1.04e-04	49.7	3993	0.017	0.006	VP13B_MOUSE Intermembrane lipid transfer protein VPS13B OS=Mus musculus OX=10090 GN=Vps13b PE=1 SV=3
4	Q7Z7G8	1.58e-04	48.9	4022	0.017	0.006	VP13B_HUMAN Intermembrane lipid transfer protein VPS13B OS=Homo sapiens OX=9606 GN=VPS13B PE=1 SV=2
5	Q54KX3	3.40e-04	48.1	4246	0.017	0.006	VP13F_DICDI Intermembrane lipid transfer protein vps13F OS=Dictyostelium discoideum OX=44689 GN=vps13F PE=3 SV=1
6	Q9FT44	4.32e-04	47.8	3306	0.019	0.008	Q9FT44_ARATH VPS13-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g24740 PE=3 SV=1
7	F4KIH9	4.33e-04	47.8	3464	0.019	0.008	F4KIH9_ARATH Vacuolar protein sorting-associated protein, putative (DUF1162) OS=Arabidopsis thaliana OX=3702 GN=SHBY PE=1 SV=1
8	F4JNE2	0.007	43.5	4219	0.014	0.005	F4JNE2_ARATH Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DL4605C PE=1 SV=1
9	F4HWS2	0.023	42.0	4146	0.017	0.006	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
10	Q55FG3	0.14	39.3	3848	0.017	0.006	VP13C_DICDI Intermembrane lipid transfer protein tipC OS=Dictyostelium discoideum OX=44689 GN=tipC PE=3 SV=1
11	Q21480	0.24	38.5	2290	0.015	0.009	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3
12	A1Z713	2.1	35.4	3321	0.026	0.011	VPS13_DROME Intermembrane lipid transfer protein Vps13 OS=Drosophila melanogaster OX=7227 GN=Vps13 PE=1 SV=2
13	Q9UTN7	2.1	33.9	178	0.012	0.096	MUG95_SCHPO Meiotically up-regulated gene 95 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug95 PE=1 SV=1
14	Q9LSY5	2.5	35.0	495	0.019	0.055	U71B7_ARATH UDP-glycosyltransferase 71B7 OS=Arabidopsis thaliana OX=3702 GN=UGT71B7 PE=2 SV=2
15	G0S3B8	3.0	35.0	3225	0.014	0.006	VPS13_CHATD Intermembrane lipid transfer protein VPS13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=VPS13 PE=1 SV=1
16	Q5THJ4	4.0	34.7	4388	0.013	0.004	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
17	P19524	5.7	33.9	1574	0.024	0.022	MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO2 PE=1 SV=1
18	Q67X99	7.7	33.1	354	0.017	0.068	TPPE_ARATH Probable trehalose-phosphate phosphatase E OS=Arabidopsis thaliana OX=3702 GN=TPPE PE=2 SV=1
19	Q8N2C7	9.0	33.5	3258	0.015	0.007	UNC80_HUMAN Protein unc-80 homolog OS=Homo sapiens OX=9606 GN=UNC80 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12624 Chorein_N	4.6e-14	63.9	N-terminal region of Chorein or VPS13

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000192788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244520	0.697	U1 small nuclear ribonucleoprotein C
2	9606.ENSP00000229771	0.672	Tubby-related protein 1
3	9606.ENSP00000470252	0.650	Transcription elongation factor SPT5
4	9606.ENSP00000363064	0.642	Zinc finger protein 76
5	9606.ENSP00000381567	0.620	TATA element modulatory factor
6	9606.ENSP00000232603	0.603	MORC family CW-type zinc finger protein 1
7	9606.ENSP00000318086	0.588	MAP7 domain-containing protein 3
8	9606.ENSP00000353518	0.587	Ankyrin repeat and SAM domain-containing protein 1A
9	9606.ENSP00000229769	0.584	Fanconi anemia group E protein
10	9606.ENSP00000320563	0.552	WD repeat- and FYVE domain-containing protein 4
11	9606.ENSP00000348472	0.531	PX domain-containing protein kinase-like protein
12	9606.ENSP00000317891	0.529	TNFAIP3-interacting protein 1
13	9606.ENSP00000363135	0.527	Uncharacterized protein C6orf106
14	9606.ENSP00000264555	0.518	PHD and RING finger domain-containing protein 1
15	9606.ENSP00000368540	0.518	Ubiquitin associated protein 2
16	9606.ENSP00000262102	0.517	Microtubule-associated tumor suppressor 1
17	9606.ENSP00000283928	0.517	Juxtaposed with another zinc finger protein 1
18	9606.ENSP00000400906	0.503	Ubiquitin-conjugating enzyme E2L 3
19	9606.ENSP00000485133	0.503	Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-live [...]
20	9606.ENSP00000481575	0.500	Nuclear envelope pore membrane protein POM 121C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0042826	1.000	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.884	regulation of cellular process
GO:0051179	0.726	localization
GO:0071840	0.722	cellular component organization or biogenesis
GO:0016043	0.693	cellular component organization
GO:0051234	0.618	establishment of localization
GO:0019222	0.482	regulation of metabolic process
GO:0008152	0.481	metabolic process
GO:0006810	0.454	transport
GO:0031323	0.446	regulation of cellular metabolic process
GO:0048518	0.385	positive regulation of biological process
GO:0044237	0.372	cellular metabolic process
GO:0048522	0.343	positive regulation of cellular process
GO:0051641	0.303	cellular localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0005770	0.986	late endosome
GO:0005634	0.492	nucleus
GO:0005829	0.423	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]