StarFunc result for job id Q6DHV5

User Input

>input (1437 residues)
MKKSQREDIFKKMSEEMDNITAEEIIDKHLQKDLDAEENQNVAKTLRGKVREKLKISKIN
KGEKSSTEQLIDSEIHQRSKLSPQTEVSLDESLSFFILSGEEGSALGKSSEQRPVNRSYP
KCFSLGVNLQNVAESEEEEFMKEFILTDILKVKAADYEDDQEQIKKQKANIFVPSSSPVV
NQRKLPKDMMPRILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPT
PIKQSWNFRLNVRKEPLNPLLKTIYRKAVKYDLGSSFMNKMEGSREIYQLDLNIVGLQFS
HHHLFNQEQVLCARLLQLYECFQDRQQQNVSQLLYEKLKALTDATKLSNENSEINQLTRK
SLQDYYWQISNTKQMYDLERGKDLSLLHSILRTWKQIKSLRHGQGFTSTPIKLQVQRIKM
NKCDEQEQISEMSETEKKNEGKELKNGKKLESLSYLASDETEIERIKPITLRPQLSFTAE
LTSLSKCSLHEQKRRAKIQKLKYFIKIFYNNKQVSCTSVSPLQFDFKVMFQQIFNIQLMY
WPEVICLEVYEKSKRTSLLAKLYIPLPNYTELKGKTALQYVEFSSDKLVMPADGEVGSNV
PFLLEGNGTEELCLLTSGKLSYSLSWSLDENGLPLIPMPQSLRSSYCSMLRNVDARSVPG
IPWLMNEQKLFEWANEVRIDPNNPEYSDLMESVTYMRLKGQDIPKYFRLEQLQDEFNFVS
EEEMAKSKRFQLLQLRNAGQLDNFLLQQMPLHDTEIPDLVFQEYESQKEKEVSVSDVNSI
TAQRINSANFLKKVRRLIMKRIVKISKCNLSDIVNDYEEIVSTSQLTDAVCKFVEPRRKL
KPQRKERKKVTAQAISDGDIKILVRIVRAYNIPTRKTTINGSLDMPTCLKSSISCLRHRE
TIKSVASDETLHEDTVHPFVEVSFQHTVYKTNTASGSHPCWNEEIKVDFVSPGHDYSFSS
LSKIKDNIYINIFDEMMTEKHEDHCLKSCSGHSYIRKNWLGCIVFPFSALLQQSEISGTF
QVTIPPVLLGYTWSNTYVFPKEDSNEQNLKECTFLNIFATIEPQISYVTCNPTLDKFLDQ
TEVLQRAQIFKKNCKAMFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNA
TFDLIARFVSLIPFVPNTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGKKA
LVLLGTSVLEGHVAYVVTQETNEYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNI
QQNNTPMAVFFDYSKESFWKQLLPKNVQGTKIQSIQPEEIIYFETDKSMVEDLRNRIERT
LKSKVMEWRPKHPTHWNRQCTFILRQILPKLEFGIGSFVSSEGDNEFERILQFYWVTGFP
IQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVYIHPYPNNILSVWVYLASLVQHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QEZ0	0.517	0.452	0.000	1675	0.365	0.313	A0A2R8QEZ0.pdb.gz
2	PDB:1cjyA	0.073	0.155	1.539E-6	633	0.035	0.079	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
3	PDB:5ixcA	0.063	0.127	2.159E-5	684	0.033	0.070	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
4	PDB:5iz5B	0.064	0.119	2.377E-5	746	0.043	0.083	5iz5B.pdb.gz
5	PDB:7lq1A	0.082	0.114	1.216E-4	950	0.021	0.032	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
6	PDB:5iz5A	0.048	0.082	1.276E-4	757	0.037	0.070	5iz5A.pdb.gz
7	PDB:5a50A	0.069	0.514	1.405E-4	165	0.020	0.176	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
8	PDB:5izrC	0.063	0.131	1.966E-4	659	0.032	0.070	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
9	AFDB:P11274	0.081	0.090	3.037E-4	1271	0.095	0.108	P11274.pdb.gz	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
10	PDB:4rj9A	0.064	0.505	3.499E-4	161	0.020	0.180	4rj9A.pdb.gz
11	PDB:4yknA	0.091	0.106	6.532E-4	1205	0.028	0.033	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
12	PDB:6gy0A	0.077	0.117	9.592E-4	822	0.018	0.032	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
13	AFDB:X2JC00	0.070	0.071	2.074E-3	1404	0.088	0.090	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
14	AFDB:Q7TN83	0.049	0.098	8.348E-3	639	0.065	0.147	Q7TN83.pdb.gz	SYT16_MOUSE Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16 PE=1 SV=1
15	AFDB:Q8NDI1	0.034	0.039	3.881E-2	1231	0.106	0.124	Q8NDI1.pdb.gz	EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1 PE=1 SV=3
16	AFDB:Q8BI84	0.034	0.031	9.213E-2	1930	0.064	0.048	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
17	AFDB:Q9WUX5	0.052	0.076	1.353E-1	899	0.057	0.091	Q9WUX5.pdb.gz	IRAG1_MOUSE Inositol 1,4,5-triphosphate receptor associated 1 OS=Mus musculus OX=10090 GN=Irag1 PE=1 SV=2
18	AFDB:A4UZL3	0.064	0.078	1.639E-1	1141	0.061	0.077	A4UZL3.pdb.gz	A4UZL3_DROME Eps15 homology domain containing protein-binding protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Ehbp1 PE=1 SV=1
19	AFDB:Q17RD7	0.050	0.103	2.187E-1	645	0.061	0.135	Q17RD7.pdb.gz	SYT16_HUMAN Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 PE=1 SV=2
20	AFDB:Q9HCH5	0.045	0.068	2.526E-1	934	0.061	0.094	Q9HCH5.pdb.gz	SYTL2_HUMAN Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CFW7	0.0	828	1633	0.290	0.255	C2D2A_MOUSE Coiled-coil and C2 domain-containing protein 2A OS=Mus musculus OX=10090 GN=Cc2d2a PE=1 SV=1
2	Q9P2K1	0.0	978	1620	0.390	0.346	C2D2A_HUMAN Coiled-coil and C2 domain-containing protein 2A OS=Homo sapiens OX=9606 GN=CC2D2A PE=1 SV=3
3	A1ZAV1	1.69e-54	211	1336	0.193	0.207	C2D2A_DROME Coiled-coil and C2 domain-containing protein 2A OS=Drosophila melanogaster OX=7227 GN=Cc2d2a PE=1 SV=2
4	Q21303	3.44e-36	152	1202	0.113	0.136	Q21303_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mks-6 PE=4 SV=1
5	Q38F79	2.28e-23	110	1608	0.105	0.094	Q38F79_TRYB2 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3240 PE=4 SV=1
6	Q8TAP6	2.42e-15	83.6	659	0.065	0.141	CEP76_HUMAN Centrosomal protein of 76 kDa OS=Homo sapiens OX=9606 GN=CEP76 PE=1 SV=1
7	Q384E2	4.66e-13	76.3	632	0.049	0.111	Q384E2_TRYB2 CEP76 C2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0600 PE=4 SV=1
8	Q8I4Z1	0.004	44.3	1846	0.053	0.041	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
9	A0A0S2Z475	1.3	35.8	465	0.017	0.052	A0A0S2Z475_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
10	A0A0S2Z4A3	1.8	35.4	533	0.017	0.045	A0A0S2Z4A3_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
11	A0A0S2Z4T6	1.8	35.4	593	0.017	0.040	A0A0S2Z4T6_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
12	O76083	1.8	35.4	593	0.017	0.040	PDE9A_HUMAN High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Homo sapiens OX=9606 GN=PDE9A PE=1 SV=1
13	Q3T905	3.5	34.3	429	0.015	0.051	CBPB_HELZE Carboxypeptidase B OS=Helicoverpa zea OX=7113 GN=CPB PE=1 SV=1
14	O75170	6.0	33.9	966	0.030	0.045	PP6R2_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2
15	O60054	6.3	33.5	380	0.017	0.066	ARP10_SCHPO Actin-like protein arp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp10 PE=3 SV=1
16	Q55434	6.4	33.9	1276	0.020	0.023	PHY2_SYNY3 Phytochrome-like protein cph2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=cph2 PE=1 SV=1
17	B2D6M2	7.0	33.5	612	0.015	0.034	LIN61_CAEEL Protein lin-61 OS=Caenorhabditis elegans OX=6239 GN=lin-61 PE=1 SV=1
18	Q9FLG2	7.2	33.1	394	0.018	0.066	MRS22_ARATH Magnesium transporter MRS2-2 OS=Arabidopsis thaliana OX=3702 GN=MRS2-2 PE=2 SV=1
19	Q9M2T2	8.2	32.0	156	0.010	0.090	PP16A_ARATH 16 kDa phloem protein 1 OS=Arabidopsis thaliana OX=3702 GN=PP16-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15625 CC2D2AN-C2	9.3e-52	186.7	CC2D2A N-terminal C2 domain
2	PF17661 DUF5523	1.8e-58	209.8	Family of unknown function (DUF5523)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005566117.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005563755.1	0.778	Transmembrane protein 67
2	9541.XP_005583880.1	0.765	Uncharacterized protein
3	9541.XP_005589397.1	0.751	Uncharacterized protein
4	9541.XP_005572309.1	0.722	Uncharacterized protein
5	9541.XP_005595266.1	0.705	Uncharacterized protein
6	9541.XP_005576819.1	0.667	LOW QUALITY PROTEIN: transmembrane protein 80
7	9541.XP_005577714.1	0.667	Transmembrane protein 216 isoform X1
8	9541.XP_005578999.1	0.665	Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
9	9541.XP_005566115.1	0.627	Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition. May be involved in apoptosis regulation (By similarity). Necessary for signal transduction through the sonic hedgehog (Shh) signaling pathway (By similarity)
10	9541.XP_005575303.1	0.585	Nephrocystin-1 isoform X1
11	9541.XP_005548436.1	0.552	ADP-ribosylation factor-like protein 13B isoform X1
12	9541.XP_005571875.1	0.543	Centrosomal protein of 290 kDa isoform X1
13	9541.XP_005564069.1	0.539	WD repeat-containing protein 67 isoform X1
14	9541.XP_005591990.1	0.532	Protein fantom-like isoform X1
15	9541.XP_005544996.1	0.529	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0016043	0.971	cellular component organization
GO:0065007	0.772	biological regulation
GO:0030030	0.627	cell projection organization
GO:0050789	0.623	regulation of biological process
GO:0006996	0.610	organelle organization
GO:0050794	0.572	regulation of cellular process
GO:0070925	0.541	organelle assembly
GO:0048856	0.500	anatomical structure development
GO:0060271	0.467	cilium assembly
GO:0051641	0.420	cellular localization
GO:0032501	0.389	multicellular organismal process
GO:0048731	0.319	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0043229	0.951	intracellular organelle
GO:0005929	0.895	cilium
GO:0043232	0.727	intracellular non-membrane-bounded organelle
GO:0016020	0.722	membrane
GO:0032991	0.612	protein-containing complex
GO:0043231	0.567	intracellular membrane-bounded organelle
GO:0005634	0.481	nucleus
GO:0043005	0.383	neuron projection
GO:0032391	0.369	photoreceptor connecting cilium
GO:0070013	0.357	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]