StarFunc result for job id Q6DKI2

User Input

>input (356 residues)
MAFSGCQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSCSGTRFAVDFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQKGTWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRAVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSK
SIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3B8N2	0.985	0.985	1.760E-65	356	0.989	0.989	Q3B8N2.pdb.gz	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
2	AFDB:A0A024QZ02	0.834	0.919	1.422E-57	323	0.854	0.941	A0A024QZ02.pdb.gz
3	AFDB:O08573	0.789	0.795	1.330E-52	353	0.688	0.694	O08573.pdb.gz	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	AFDB:P97840	0.469	0.472	4.901E-52	354	0.708	0.712	P97840.pdb.gz	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	AFDB:P56470	0.594	0.645	1.003E-33	323	0.362	0.399	P56470.pdb.gz	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
6	AFDB:J3QR96	0.545	0.784	1.277E-33	246	0.624	0.902	J3QR96.pdb.gz	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
7	AFDB:Q8K419	0.579	0.622	2.280E-33	326	0.371	0.405	Q8K419.pdb.gz	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
8	AFDB:O00214	0.408	0.457	3.753E-32	317	0.312	0.350	O00214.pdb.gz	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
9	AFDB:Q9JL15	0.391	0.440	1.847E-31	316	0.309	0.348	Q9JL15.pdb.gz	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
10	AFDB:O54891	0.579	0.664	3.461E-31	301	0.351	0.415	O54891.pdb.gz	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
11	PDB:6m5yA	0.340	0.438	2.580E-19	270	0.205	0.270	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
12	PDB:3vv1A	0.366	0.902	8.605E-13	141	0.110	0.277	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
13	PDB:3zxfB	0.351	0.888	2.742E-12	138	0.146	0.377	3zxfB.pdb.gz
14	PDB:6ljqA	0.363	0.894	3.546E-11	140	0.126	0.321	6ljqA.pdb.gz	Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity.
15	PDB:5xg7A	0.360	0.889	4.515E-11	139	0.118	0.302	5xg7A.pdb.gz
16	PDB:6l6aA	0.362	0.878	7.318E-11	142	0.118	0.296	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
17	PDB:1w6mA	0.340	0.866	5.564E-10	134	0.110	0.291	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
18	PDB:4ga9A	0.345	0.872	1.327E-9	134	0.096	0.254	4ga9A.pdb.gz	Gal-1 structure analysis
19	PDB:6k2zA	0.304	0.748	1.327E-9	138	0.118	0.304	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.
20	PDB:5dg2B	0.321	0.843	1.690E-9	131	0.090	0.244	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KSY2	0.0	647	323	0.907	1.000	J3KSY2_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
2	O00182	0.0	689	355	0.941	0.944	LEG9_HUMAN Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2
3	O08573	0.0	506	353	0.688	0.694	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	P97840	0.0	518	354	0.708	0.712	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	Q3B8N2	0.0	725	356	0.989	0.989	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
6	Q6DKI2	0.0	734	356	1.000	1.000	LEG9C_HUMAN Galectin-9C OS=Homo sapiens OX=9606 GN=LGALS9C PE=1 SV=2
7	J3QR96	7.67e-153	431	246	0.621	0.898	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
8	J3KT17	3.96e-142	404	234	0.587	0.893	J3KT17_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
9	J3QSH0	1.17e-105	309	175	0.416	0.846	J3QSH0_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
10	J3KS82	2.94e-98	290	175	0.390	0.794	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
11	Q8K419	8.59e-64	207	326	0.368	0.402	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
12	P56470	1.07e-60	199	323	0.354	0.390	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
13	O54891	2.99e-56	187	301	0.348	0.412	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
14	Q9JL15	4.99e-54	182	316	0.315	0.354	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
15	O00214	5.19e-53	179	317	0.315	0.353	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
16	Q91VD1	2.99e-32	124	314	0.272	0.309	LEG12_MOUSE Galectin-12 OS=Mus musculus OX=10090 GN=Lgals12 PE=1 SV=2
17	Q96DT0	1.39e-29	118	336	0.275	0.292	LEG12_HUMAN Galectin-12 OS=Homo sapiens OX=9606 GN=LGALS12 PE=1 SV=1
18	P16110	2.70e-29	115	264	0.185	0.250	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
19	Q6NVH9	6.72e-28	111	250	0.199	0.284	Q6NVH9_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
20	A0A024R693	7.53e-28	111	250	0.163	0.232	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00337 Gal-bind_lectin	1.4e-71	249.7	Galactoside-binding lectin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362092	0.839	Ras-related GTP-binding protein C
2	9606.ENSP00000262461	0.746	Solute carrier family 12 member 2
3	9606.ENSP00000312002	0.743	Hepatitis A virus cellular receptor 2
4	9606.ENSP00000378856	0.735	Galectin-9
5	9606.ENSP00000262850	0.714	Ras-related GTP-binding protein B
6	9606.ENSP00000254301	0.713	Galectin-3
7	9606.ENSP00000264930	0.688	Solute carrier family 12 member 7
8	9606.ENSP00000395983	0.682	Solute carrier family 12 member 4
9	9606.ENSP00000346112	0.675	Solute carrier family 12 member 6
10	9606.ENSP00000380074	0.674	Sodium-coupled neutral amino acid transporter 9
11	9606.ENSP00000295736	0.638	Sodium bicarbonate cotransporter 3
12	9606.ENSP00000386710	0.635	Autophagy-related protein 9A
13	9606.ENSP00000398632	0.629	CD44 antigen
14	9606.ENSP00000366084	0.615	Multidrug resistance-associated protein 4
15	9606.ENSP00000411355	0.571	Receptor-type tyrosine-protein phosphatase C
16	9606.ENSP00000358501	0.518	Lymphocyte function-associated antigen 3
17	9606.ENSP00000336733	0.502	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.934	carbohydrate binding
GO:0097367	0.610	carbohydrate derivative binding
GO:0019899	0.592	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0002684	0.993	positive regulation of immune system process
GO:0048583	0.992	regulation of response to stimulus
GO:0050896	0.990	response to stimulus
GO:0050794	0.968	regulation of cellular process
GO:0002376	0.965	immune system process
GO:0051716	0.954	cellular response to stimulus
GO:0050776	0.953	regulation of immune response
GO:0048584	0.953	positive regulation of response to stimulus
GO:0042221	0.951	response to chemical
GO:0001817	0.945	regulation of cytokine production
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0048585	0.940	negative regulation of response to stimulus
GO:0080090	0.939	regulation of primary metabolic process
GO:0010033	0.938	response to organic substance
GO:0051249	0.938	regulation of lymphocyte activation
GO:0050863	0.930	regulation of T cell activation
GO:1903037	0.926	regulation of leukocyte cell-cell adhesion
GO:0048523	0.924	negative regulation of cellular process
GO:0032101	0.917	regulation of response to external stimulus
GO:0023051	0.913	regulation of signaling
GO:0010646	0.913	regulation of cell communication
GO:0048522	0.908	positive regulation of cellular process
GO:0031347	0.908	regulation of defense response
GO:0009966	0.900	regulation of signal transduction
GO:0002831	0.899	regulation of response to biotic stimulus
GO:0007154	0.897	cell communication
GO:0060627	0.897	regulation of vesicle-mediated transport
GO:0032501	0.889	multicellular organismal process
GO:0065009	0.888	regulation of molecular function
GO:0051246	0.885	regulation of protein metabolic process
GO:0030334	0.884	regulation of cell migration
GO:0009605	0.881	response to external stimulus
GO:0050790	0.872	regulation of catalytic activity
GO:0032103	0.871	positive regulation of response to external stimulus
GO:0002697	0.868	regulation of immune effector process
GO:0051241	0.859	negative regulation of multicellular organismal process
GO:0009892	0.858	negative regulation of metabolic process
GO:0010605	0.853	negative regulation of macromolecule metabolic process
GO:0045088	0.848	regulation of innate immune response
GO:0051051	0.834	negative regulation of transport
GO:0032944	0.833	regulation of mononuclear cell proliferation
GO:0070887	0.830	cellular response to chemical stimulus
GO:0051240	0.827	positive regulation of multicellular organismal process
GO:1903039	0.823	positive regulation of leukocyte cell-cell adhesion
GO:0051251	0.823	positive regulation of lymphocyte activation
GO:0007162	0.814	negative regulation of cell adhesion
GO:0023052	0.811	signaling
GO:0030335	0.807	positive regulation of cell migration
GO:0050670	0.806	regulation of lymphocyte proliferation
GO:0002695	0.801	negative regulation of leukocyte activation
GO:0010628	0.796	positive regulation of gene expression
GO:0009967	0.789	positive regulation of signal transduction
GO:1903555	0.788	regulation of tumor necrosis factor superfamily cytokine production
GO:0007165	0.786	signal transduction
GO:0032680	0.777	regulation of tumor necrosis factor production
GO:0001819	0.776	positive regulation of cytokine production
GO:0050870	0.755	positive regulation of T cell activation
GO:0050778	0.738	positive regulation of immune response
GO:0051707	0.735	response to other organism
GO:0006950	0.731	response to stress
GO:0050777	0.728	negative regulation of immune response
GO:0050793	0.726	regulation of developmental process
GO:0006952	0.722	defense response
GO:1903530	0.692	regulation of secretion by cell
GO:0031323	0.690	regulation of cellular metabolic process
GO:0032675	0.689	regulation of interleukin-6 production
GO:0042129	0.682	regulation of T cell proliferation
GO:0050868	0.679	negative regulation of T cell activation
GO:0002698	0.676	negative regulation of immune effector process
GO:0071677	0.675	positive regulation of mononuclear cell migration
GO:0051173	0.645	positive regulation of nitrogen compound metabolic process
GO:1902531	0.638	regulation of intracellular signal transduction
GO:0031341	0.614	regulation of cell killing
GO:0032945	0.614	negative regulation of mononuclear cell proliferation
GO:1903708	0.614	positive regulation of hemopoiesis
GO:0002706	0.595	regulation of lymphocyte mediated immunity
GO:1902105	0.589	regulation of leukocyte differentiation
GO:0022414	0.583	reproductive process
GO:0008152	0.577	metabolic process
GO:0001910	0.574	regulation of leukocyte mediated cytotoxicity
GO:0002704	0.573	negative regulation of leukocyte mediated immunity
GO:0002715	0.573	regulation of natural killer cell mediated immunity
GO:0009617	0.556	response to bacterium
GO:0044093	0.530	positive regulation of molecular function
GO:0048856	0.507	anatomical structure development
GO:0009615	0.486	response to virus
GO:0051179	0.418	localization
GO:0071310	0.414	cellular response to organic substance
GO:1901700	0.405	response to oxygen-containing compound
GO:0045089	0.389	positive regulation of innate immune response
GO:0042981	0.379	regulation of apoptotic process
GO:0098586	0.319	cellular response to virus
GO:0071704	0.311	organic substance metabolic process
GO:0098542	0.309	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0071944	0.822	cell periphery
GO:0043227	0.796	membrane-bounded organelle
GO:0043229	0.784	intracellular organelle
GO:0043231	0.774	intracellular membrane-bounded organelle
GO:0005886	0.317	plasma membrane
GO:0005634	0.317	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]