StarFunc result for job id Q6DKJ4

User Input

>input (435 residues)
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRL
RGDAAAGPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRK
LKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLR
NNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSE
ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDE
DCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYK
AKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA
FVNDFLAEKLKPEPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97346	0.967	0.967	2.547E-91	435	0.979	0.979	P97346.pdb.gz	NXN_MOUSE Nucleoredoxin OS=Mus musculus OX=10090 GN=Nxn PE=1 SV=1
2	AFDB:O80763	0.336	0.260	1.725E-29	578	0.269	0.202	O80763.pdb.gz	NRX1_ARATH Probable nucleoredoxin 1 OS=Arabidopsis thaliana OX=3702 GN=At1g60420 PE=1 SV=1
3	AFDB:Q9ZR86	0.364	0.294	1.747E-28	569	0.239	0.183	Q9ZR86.pdb.gz	Q9ZR86_MAIZE PDI-like protein OS=Zea mays OX=4577 PE=2 SV=1
4	AFDB:Q57WB2	0.298	0.869	9.911E-14	144	0.129	0.389	Q57WB2.pdb.gz	Q57WB2_TRYB2 Tryparedoxin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.740 PE=4 SV=1
5	AFDB:Q960C0	0.194	0.168	5.375E-12	510	0.154	0.131	Q960C0.pdb.gz	Q960C0_DROME SD08104p OS=Drosophila melanogaster OX=7227 GN=CG9302 PE=2 SV=1
6	AFDB:Q9FF55	0.277	0.222	7.179E-12	597	0.133	0.097	Q9FF55.pdb.gz	PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-4 PE=1 SV=1
7	AFDB:Q582M8	0.294	0.619	9.049E-12	198	0.110	0.242	Q582M8.pdb.gz	Q582M8_TRYB2 Tryparedoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.910 PE=4 SV=1
8	AFDB:P38659	0.254	0.183	9.588E-12	643	0.172	0.117	P38659.pdb.gz	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
9	AFDB:Q9D531	0.285	0.767	1.076E-11	156	0.103	0.288	Q9D531.pdb.gz	NXNL2_MOUSE Nucleoredoxin-like protein 2 OS=Mus musculus OX=10090 GN=Nxnl2 PE=1 SV=1
10	AFDB:P13667	0.233	0.177	1.357E-11	645	0.156	0.105	P13667.pdb.gz	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
11	PDB:4ekzA	0.235	0.221	2.027E-9	469	0.131	0.122	4ekzA.pdb.gz
12	PDB:7f05C	0.244	0.289	2.587E-8	355	0.115	0.141	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
13	PDB:7aooA	0.242	0.588	3.661E-8	168	0.055	0.143	7aooA.pdb.gz
14	PDB:5gu6A	0.231	0.261	1.961E-7	377	0.138	0.159	5gu6A.pdb.gz
15	PDB:3f8uA	0.260	0.243	3.707E-7	469	0.136	0.126	3f8uA.pdb.gz
16	PDB:5crgA	0.243	0.290	6.612E-7	354	0.110	0.136	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
17	PDB:3apoA	0.195	0.130	1.051E-6	688	0.120	0.076	3apoA.pdb.gz
18	PDB:3iosA	0.235	0.667	1.403E-6	134	0.048	0.157	3iosA.pdb.gz
19	PDB:4f9zA	0.275	0.489	1.403E-6	219	0.080	0.160	4f9zA.pdb.gz
20	PDB:2r2jA	0.255	0.312	2.229E-6	328	0.129	0.171	2r2jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97346	0.0	872	435	0.979	0.979	NXN_MOUSE Nucleoredoxin OS=Mus musculus OX=10090 GN=Nxn PE=1 SV=1
2	Q6DKJ4	0.0	888	435	1.000	1.000	NXN_HUMAN Nucleoredoxin OS=Homo sapiens OX=9606 GN=NXN PE=1 SV=2
3	O80763	3.68e-45	167	578	0.230	0.173	NRX1_ARATH Probable nucleoredoxin 1 OS=Arabidopsis thaliana OX=3702 GN=At1g60420 PE=1 SV=1
4	Q9ZR86	2.35e-38	148	569	0.214	0.163	Q9ZR86_MAIZE PDI-like protein OS=Zea mays OX=4577 PE=2 SV=1
5	Q57WB4	2.69e-30	116	144	0.129	0.389	Q57WB4_TRYB2 Tryparedoxin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.710 PE=4 SV=1
6	Q57WB2	3.14e-30	116	144	0.129	0.389	Q57WB2_TRYB2 Tryparedoxin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.740 PE=4 SV=1
7	Q582M8	9.03e-17	80.5	198	0.120	0.263	Q582M8_TRYB2 Tryparedoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.910 PE=4 SV=1
8	Q9D531	7.85e-14	70.9	156	0.097	0.269	NXNL2_MOUSE Nucleoredoxin-like protein 2 OS=Mus musculus OX=10090 GN=Nxnl2 PE=1 SV=1
9	Q96CM4	4.72e-13	70.1	212	0.090	0.184	NXNL1_HUMAN Nucleoredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=NXNL1 PE=1 SV=1
10	Q8VC33	3.64e-11	64.7	217	0.090	0.180	NXNL1_MOUSE Nucleoredoxin-like protein 1 OS=Mus musculus OX=10090 GN=Nxnl1 PE=1 SV=1
11	Q94282	4.57e-10	60.5	158	0.087	0.241	Q94282_CAEEL Thioredoxin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=trx-3 PE=4 SV=2
12	Q8I224	1.09e-08	56.6	179	0.057	0.140	Q8I224_PLAF7 Plasmoredoxin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0303600 PE=1 SV=1
13	P43221	1.15e-06	51.6	221	0.083	0.163	TLPA_BRADU Thiol:disulfide interchange protein TlpA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=tlpA PE=1 SV=1
14	P35160	8.73e-06	48.1	179	0.064	0.156	RESA_BACSU Thiol-disulfide oxidoreductase ResA OS=Bacillus subtilis (strain 168) OX=224308 GN=resA PE=1 SV=2
15	Q42403	0.074	35.8	118	0.048	0.178	TRXH3_ARATH Thioredoxin H3 OS=Arabidopsis thaliana OX=3702 GN=TRX3 PE=1 SV=1
16	O06392	0.085	37.0	216	0.069	0.139	O06392_MYCTU Possible thioredoxin protein (Thiol-disulfide interchange protein) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0526 PE=1 SV=1
17	H0Y3Z3	0.10	37.4	418	0.136	0.141	H0Y3Z3_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=2
18	Q39241	0.26	34.3	118	0.037	0.136	TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana OX=3702 GN=TRX5 PE=1 SV=1
19	Q38BK3	0.32	35.8	516	0.062	0.052	Q38BK3_TRYB2 Thioredoxin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3320 PE=4 SV=1
20	P0AA86	0.38	34.7	185	0.117	0.276	DSBE_ECOLI Thiol:disulfide interchange protein DsbE OS=Escherichia coli (strain K12) OX=83333 GN=dsbE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	3e-05	35.3	AhpC/TSA family
2	PF00462 Glutaredoxin	5.8	18.5	Glutaredoxin
3	PF08534 Redoxin	0.0077	27.4	Redoxin
4	PF02630 SCO1-SenC	2.8	19.4	SCO1/SenC
5	PF00085 Thioredoxin	0.00022	32.5	Thioredoxin
6	PF13098 Thioredoxin_2	7.6e-11	53.8	Thioredoxin-like domain
7	PF13848 Thioredoxin_6	0.0005	31.5	Thioredoxin-like domain
8	PF13899 Thioredoxin_7	0.14	23.6	Thioredoxin-like
9	PF13905 Thioredoxin_8	2.4e-50	180.1	Thioredoxin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337443

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368169	0.990	Segment polarity protein dishevelled homolog DVL-1
2	9606.ENSP00000219197	0.944	Cerebellin-1
3	9606.ENSP00000392500	0.886	Neuroligin-1
4	9606.ENSP00000357998	0.855	Translocation protein SEC63 homolog
5	9606.ENSP00000304908	0.767	Thioredoxin domain-containing protein 2
6	9606.ENSP00000264638	0.764	Contactin-associated protein 1
7	9606.ENSP00000005340	0.747	Segment polarity protein dishevelled homolog DVL-2
8	9606.ENSP00000263713	0.740	Band 4.1-like protein 5
9	9606.ENSP00000349204	0.729	Protein crumbs homolog 3
10	9606.ENSP00000266546	0.724	Calsyntenin-3
11	9606.ENSP00000274711	0.705	Leucine-rich repeat transmembrane neuronal protein 2
12	9606.ENSP00000393952	0.698	Tetratricopeptide repeat domain containing
13	9606.ENSP00000363641	0.695	Thioredoxin
14	9606.ENSP00000238156	0.688	Coiled-coil domain containing 92
15	9606.ENSP00000362550	0.681	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
16	9606.ENSP00000434516	0.668	Thioredoxin reductase 1, cytoplasmic
17	9606.ENSP00000228284	0.656	Squamous cell carcinoma antigen recognized by T-cells 3
18	9606.ENSP00000362734	0.645	Protein crumbs homolog 2
19	9606.ENSP00000360688	0.621	Thioredoxin domain-containing protein 12
20	9606.ENSP00000265459	0.612	Neurexin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004791	1.000	thioredoxin-disulfide reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.976	response to stimulus
GO:0007154	0.960	cell communication
GO:0023052	0.959	signaling
GO:0032502	0.955	developmental process
GO:0051716	0.953	cellular response to stimulus
GO:0048856	0.949	anatomical structure development
GO:0007165	0.940	signal transduction
GO:0032501	0.927	multicellular organismal process
GO:0007267	0.924	cell-cell signaling
GO:0019222	0.917	regulation of metabolic process
GO:0007275	0.904	multicellular organism development
GO:0198738	0.872	cell-cell signaling by wnt
GO:0048519	0.842	negative regulation of biological process
GO:0060255	0.841	regulation of macromolecule metabolic process
GO:0080090	0.808	regulation of primary metabolic process
GO:0007166	0.779	cell surface receptor signaling pathway
GO:0048583	0.774	regulation of response to stimulus
GO:0051171	0.765	regulation of nitrogen compound metabolic process
GO:1905114	0.712	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0009966	0.657	regulation of signal transduction
GO:0048523	0.633	negative regulation of cellular process
GO:0051246	0.607	regulation of protein metabolic process
GO:0031399	0.517	regulation of protein modification process
GO:0009792	0.467	embryo development ending in birth or egg hatching
GO:0016055	0.455	Wnt signaling pathway
GO:0048731	0.385	system development
GO:0043009	0.383	chordate embryonic development
GO:0009892	0.309	negative regulation of metabolic process
GO:1903320	0.302	regulation of protein modification by small protein conjugation or removal
GO:0010605	0.301	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.877	cytoplasm
GO:0005829	0.723	cytosol
GO:0016020	0.512	membrane
GO:0071944	0.402	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20345	1.000	[thioredoxin]-dithiol + NADP(+) = [thioredoxin]-disulfide + H(+) + NADPH
EC:1.8.1.9	1.000	thioredoxin-disulfide reductase.

[back to server]