StarFunc result for job id Q6DN14

User Input

>input (999 residues)
MEPRAAAAGEPEPPAASSSFQARLWKNLQLGVGRSKGGGGGRAGGPERRTADTPSPSPPP
PVGTGNAPARGSGAGSRWSGFKKRKQVLDRVFSSSQPNLCCSSPEPLEPGGAGRAEQGST
LRRRIREHLLPAVKGPAAASGAAGGTPPGGRSPDSAPSSSSASSSLSSSPQPPPRGDRAR
DEGARRQGPGAHLCHQKSSSLPGTACLEQLLEPPPPPAEPARSPAESRAPETGEEHGSSQ
KIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSDPYVKFKIGGKEVFRSKI
IHKNLNPVWEEKACILVDHLREPLYIKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTL
TLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKELSENEVVGSYFSVKS
LFWRTCGRPALPVLGFCRAELQNPYCKNVQFQTQSLRLSDLHRKSHLWRGIVSITLIEGR
DLKAMDSNGLSDPYVKFRLGHQKYKSKIMPKTLNPQWREQFDFHLYEERGGVIDITAWDK
DAGKRDDFIGRCQVDLSALSREQTHKLELQLEEGEGHLVLLVTLTASATVSISDLSVNSL
EDQKEREEILKRYSPLRIFHNLKDVGFLQVKVIRAEGLMAADVTGKSDPFCVVELNNDRL
LTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDRDRSADFLGKVAIPLLSIQNGEQK
AYVLKNKQLTGPTKGVIYLEIDVIFNAVKASLRTLIPKEQKYIEEENRLSKQLLLRNFIR
MKRCVMVLVNAAYYVNSCFDWDSPPRSLAAFVLFLFVVWNFELYMIPLVLLLLLTWNYFL
IISGKDNRQRDTVVEDMLEDEEEEDDKDDKDSEKKGFINKIYAIQEVCVSVQNILDEVAS
FGERIKNTFNWTVPFLSWLAIVALCVFTAILYCIPLRYIVLVWGINKFTKKLRSPYAIDN
NELLDFLSRVPSDVQVVQYQELKPDPSHSPYKRKKNNLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4ABL6	0.521	0.544	0.000	946	0.875	0.924	D4ABL6.pdb.gz	MCTP1_RAT Multiple C2 and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Mctp1 PE=1 SV=4
2	AFDB:Q6DN14	1.000	1.000	0.000	999	1.000	1.000	Q6DN14.pdb.gz	MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MCTP1 PE=2 SV=2
3	AFDB:Q6XK20	0.099	0.090	1.652E-16	1102	0.136	0.123	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1
4	AFDB:Q99N50	0.087	0.092	1.069E-15	950	0.144	0.152	Q99N50.pdb.gz	SYTL2_MOUSE Synaptotagmin-like protein 2 OS=Mus musculus OX=10090 GN=Sytl2 PE=1 SV=2
5	AFDB:B7Z0K1	0.098	0.087	1.637E-15	1137	0.152	0.134	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
6	PDB:5iz5B	0.118	0.157	4.581E-14	746	0.047	0.063	5iz5B.pdb.gz
7	PDB:5iz5A	0.112	0.146	1.834E-13	757	0.048	0.063	5iz5A.pdb.gz
8	PDB:6kxkD	0.115	0.194	9.585E-13	553	0.070	0.127	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
9	PDB:5ixcA	0.113	0.165	4.503E-12	684	0.047	0.069	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	PDB:5izrC	0.111	0.168	2.762E-11	659	0.045	0.068	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
11	PDB:5a52A	0.107	0.659	1.592E-9	154	0.028	0.182	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
12	PDB:4rj9A	0.111	0.648	2.573E-9	161	0.032	0.199	4rj9A.pdb.gz
13	PDB:5a50A	0.111	0.646	2.863E-9	165	0.032	0.194	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
14	PDB:1cjyA	0.112	0.175	6.373E-9	633	0.024	0.038	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
15	PDB:3nsjA	0.105	0.194	1.756E-8	530	0.036	0.068	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
16	AFDB:Q9P7Y8	0.103	0.141	9.453E-8	706	0.096	0.136	Q9P7Y8.pdb.gz	MID2_SCHPO Septin ring organizing protein mid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mid2 PE=1 SV=2
17	AFDB:B7YZW3	0.060	0.033	1.762E-5	2064	0.087	0.042	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
18	AFDB:Q54NE5	0.058	0.040	3.004E-5	1918	0.113	0.059	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
19	AFDB:Q6WKZ4	0.120	0.094	6.630E-4	1283	0.045	0.035	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
20	AFDB:Q9BYH1	0.062	0.061	9.631E-4	1024	0.094	0.092	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ABL6	0.0	1565	946	0.869	0.918	MCTP1_RAT Multiple C2 and transmembrane domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Mctp1 PE=1 SV=4
2	Q6DN12	0.0	719	878	0.416	0.474	MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=3
3	Q6DN14	0.0	2056	999	1.000	1.000	MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MCTP1 PE=2 SV=2
4	A1ZBD6	3.45e-160	497	912	0.304	0.333	MCTP_DROME Multiple C2 and transmembrane domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Mctp PE=1 SV=3
5	F5H415	7.83e-41	157	396	0.098	0.247	F5H415_HUMAN Multiple C2 and transmembrane domain containing 2 OS=Homo sapiens OX=9606 GN=MCTP2 PE=1 SV=1
6	Q9SKA3	1.11e-30	133	1029	0.195	0.190	MCTP6_ARATH Multiple C2 domain and transmembrane region protein 6 OS=Arabidopsis thaliana OX=3702 GN=MCTP6 PE=2 SV=1
7	Q9M2D4	4.89e-28	124	972	0.174	0.179	MCTP8_ARATH Multiple C2 domain and transmembrane region protein 8 OS=Arabidopsis thaliana OX=3702 GN=MCTP8 PE=2 SV=1
8	Q60EW9	9.78e-24	110	774	0.121	0.156	FTIP7_ORYSJ FT-interacting protein 7 OS=Oryza sativa subsp. japonica OX=39947 GN=FTIP7 PE=1 SV=1
9	Q9M2R0	1.21e-23	110	773	0.160	0.207	FTIP3_ARATH FT-interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=FTIP3 PE=1 SV=1
10	Q9LXU2	1.25e-22	106	769	0.129	0.168	MCTP5_ARATH Multiple C2 domain and transmembrane region protein 5 OS=Arabidopsis thaliana OX=3702 GN=MCTP5 PE=2 SV=1
11	P41885	1.47e-22	107	1106	0.081	0.073	RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans OX=6239 GN=rbf-1 PE=2 SV=2
12	Q84TJ7	2.03e-22	106	1011	0.171	0.169	MCTP7_ARATH Multiple C2 domain and transmembrane region protein 7 OS=Arabidopsis thaliana OX=3702 GN=MCTP7 PE=2 SV=1
13	F1R9U1	7.71e-22	101	422	0.086	0.204	F1R9U1_DANRE Double C2-like domain-containing protein alpha OS=Danio rerio OX=7955 GN=si:dkey-93n13.3 PE=4 SV=2
14	Q768S5	1.65e-21	102	681	0.081	0.119	Q768S5_MOUSE Rabphilin OS=Mus musculus OX=10090 GN=Rph3a PE=2 SV=1
15	P47709	2.92e-21	102	684	0.081	0.118	RP3A_RAT Rabphilin-3A OS=Rattus norvegicus OX=10116 GN=Rph3a PE=1 SV=1
16	P47708	3.57e-21	101	681	0.081	0.119	RP3A_MOUSE Rabphilin-3A OS=Mus musculus OX=10090 GN=Rph3a PE=1 SV=2
17	Q9FL59	1.04e-20	100	794	0.181	0.228	FTIP1_ARATH FT-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=FTIP1 PE=1 SV=1
18	K8FE10	1.90e-20	96.7	369	0.073	0.198	SYT2_CAEEL Synaptotagmin 2 OS=Caenorhabditis elegans OX=6239 GN=snt-2 PE=1 SV=1
19	P70610	2.63e-20	97.1	412	0.077	0.187	DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus OX=10116 GN=Doc2b PE=1 SV=2
20	Q9Y2J0	3.65e-20	98.6	694	0.080	0.115	RP3A_HUMAN Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	3.3e-69	241.0	C2 domain
2	PF15627 CEP76-C2	33	15.6	CEP76 C2 domain
3	PF04842 DUF639	21	16.0	Plant protein of unknown function (DUF639)
4	PF06398 Pex24p	0.36	21.4	Integral peroxisomal membrane peroxin
5	PF08372 PRT_C	0.00064	31.0	Plant phosphoribosyltransferase C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379294	0.727	Protein FAM172A
2	9606.ENSP00000268042	0.690	Arrestin domain-containing protein 4
3	9606.ENSP00000265140	0.660	SMC5-SMC6 complex localization factor protein 1
4	9606.ENSP00000260743	0.657	Calcium homeostasis modulator protein 2
5	9606.ENSP00000376227	0.656	Transmembrane protein 44
6	9606.ENSP00000265138	0.647	Arrestin domain-containing protein 3
7	9606.ENSP00000358798	0.642	Calcium homeostasis modulator protein 3
8	9606.ENSP00000482760	0.574	Proprotein convertase subtilisin/kexin type 6
9	9606.ENSP00000274979	0.559	Anoctamin-7
10	9606.ENSP00000326267	0.559	EF-hand calcium-binding domain-containing protein 11
11	9606.ENSP00000473001	0.553	F-BAR domain only protein 1
12	9606.ENSP00000329926	0.548	Calcium homeostasis modulator protein 1
13	9606.ENSP00000377396	0.527	Protein FAM198B
14	9606.ENSP00000308024	0.517	Neuroendocrine convertase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.920	regulation of response to stimulus
GO:0009987	0.868	cellular process
GO:0048523	0.865	negative regulation of cellular process
GO:0051049	0.437	regulation of transport
GO:0051128	0.397	regulation of cellular component organization
GO:0051179	0.395	localization
GO:0048518	0.392	positive regulation of biological process
GO:0040012	0.371	regulation of locomotion
GO:0006810	0.353	transport
GO:0040013	0.336	negative regulation of locomotion
GO:0051051	0.304	negative regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.999	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0005886	0.906	plasma membrane
GO:0031982	0.876	vesicle
GO:0030054	0.714	cell junction
GO:0005829	0.582	cytosol
GO:0031410	0.534	cytoplasmic vesicle
GO:0031090	0.385	organelle membrane
GO:0045202	0.364	synapse
GO:0030133	0.358	transport vesicle
GO:0099503	0.347	secretory vesicle
GO:0008021	0.310	synaptic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]