StarFunc result for job id Q6DN72

User Input

>input (434 residues)
MLLWTAVLLFVPCVGKTVWLYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLH
FSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSP
EPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWC
EVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYS
FYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVL
FTPASNWLVPWLPASLLGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGGEQCPLYANVH
HQKGKDEGVVYSVVHRTSKRSEARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSR
TLQEPLSDCEEVLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6DN72	1.000	1.000	3.148E-70	434	1.000	1.000	Q6DN72.pdb.gz	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
2	AFDB:Q96LA5	0.387	0.333	1.811E-29	508	0.320	0.274	Q96LA5.pdb.gz	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
3	AFDB:Q96PJ5	0.430	0.367	8.593E-28	515	0.281	0.237	Q96PJ5.pdb.gz	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
4	AFDB:Q96RD9	0.386	0.182	1.733E-22	977	0.286	0.127	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
5	AFDB:Q96LA6	0.403	0.408	2.006E-22	429	0.270	0.273	Q96LA6.pdb.gz	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
6	AFDB:A1YIY0	0.393	0.601	1.050E-20	268	0.270	0.437	A1YIY0.pdb.gz	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
7	AFDB:Q7L513	0.419	0.503	3.560E-20	359	0.274	0.331	Q7L513.pdb.gz	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
8	AFDB:Q920A9	0.404	0.493	1.043E-19	352	0.244	0.301	Q920A9.pdb.gz	FCRLA_MOUSE Fc receptor-like A OS=Mus musculus OX=10090 GN=Fcrla PE=1 SV=1
9	AFDB:Q3SWT0	0.283	0.193	1.943E-17	678	0.200	0.128	Q3SWT0.pdb.gz	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
10	AFDB:P16284	0.351	0.221	2.736E-17	738	0.194	0.114	P16284.pdb.gz	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
11	PDB:5oj2B	0.295	0.202	3.698E-9	692	0.134	0.084	5oj2B.pdb.gz
12	PDB:1e07A	0.296	0.224	6.329E-9	642	0.118	0.079	1e07A.pdb.gz
13	PDB:6dldD	0.303	0.438	8.080E-9	269	0.129	0.208	6dldD.pdb.gz
14	PDB:6dlfA	0.255	0.407	6.891E-7	236	0.115	0.212	6dlfA.pdb.gz
15	PDB:5a42A	0.202	0.082	6.847E-6	1597	0.104	0.028	5a42A.pdb.gz
16	PDB:6pxvA	0.276	0.171	7.928E-6	823	0.101	0.053	6pxvA.pdb.gz
17	PDB:3o3uN	0.253	0.200	1.012E-5	580	0.085	0.064	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:1n0xL	0.202	0.325	1.063E-5	215	0.081	0.163	1n0xL.pdb.gz	Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
19	PDB:6h03A	0.240	0.112	1.231E-5	1223	0.078	0.028	6h03A.pdb.gz
20	PDB:4lnvA	0.190	0.087	1.650E-5	1276	0.076	0.026	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6DN72	0.0	891	434	1.000	1.000	FCRL6_HUMAN Fc receptor-like protein 6 OS=Homo sapiens OX=9606 GN=FCRL6 PE=1 SV=2
2	A1YIY0	1.07e-60	200	268	0.272	0.440	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
3	Q7L513	8.71e-53	182	359	0.224	0.270	FCRLA_HUMAN Fc receptor-like A OS=Homo sapiens OX=9606 GN=FCRLA PE=1 SV=2
4	Q920A9	1.24e-44	160	352	0.205	0.253	FCRLA_MOUSE Fc receptor-like A OS=Mus musculus OX=10090 GN=Fcrla PE=1 SV=1
5	Q96PJ5	5.57e-37	143	515	0.297	0.250	FCRL4_HUMAN Fc receptor-like protein 4 OS=Homo sapiens OX=9606 GN=FCRL4 PE=1 SV=1
6	P12314	1.10e-35	137	374	0.177	0.206	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
7	Q96LA5	2.54e-34	135	508	0.210	0.179	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
8	P26151	2.50e-33	131	404	0.187	0.200	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
9	Q96P31	1.66e-32	132	734	0.217	0.128	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
10	Q96RD9	1.26e-31	130	977	0.226	0.100	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
11	A0A0B4J2J0	8.89e-30	120	353	0.171	0.210	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
12	Q68SN8	2.84e-29	122	596	0.217	0.158	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
13	Q96LA6	4.36e-27	114	429	0.281	0.284	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
14	Q5DRQ8	1.21e-24	107	427	0.198	0.201	FCRLB_MOUSE Fc receptor-like B OS=Mus musculus OX=10090 GN=Fcrlb PE=2 SV=2
15	Q6BAA4	1.44e-22	101	426	0.141	0.143	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1
16	P12319	2.93e-12	68.6	257	0.071	0.121	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
17	Q2V8M5	2.89e-10	63.5	310	0.111	0.155	Q2V8M5_ICTPU FcRI OS=Ictalurus punctatus OX=7998 GN=LOC100304698 PE=2 SV=1
18	P31994	6.68e-10	62.4	310	0.136	0.190	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
19	P31995	8.13e-10	62.0	323	0.136	0.183	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
20	Q08481	2.56e-09	61.6	727	0.124	0.074	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.7e-06	38.7	Immunoglobulin I-set domain
2	PF00047 ig	6.9e-13	59.9	Immunoglobulin domain
3	PF13895 Ig_2	5.1e-24	95.7	Immunoglobulin domain
4	PF13927 Ig_3	2.1e-19	81.1	Immunoglobulin domain
5	PF16680 Ig_4	0.0051	28.7	T-cell surface glycoprotein CD3 delta chain
6	PF16681 Ig_5	29	16.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF17736 Ig_C17orf99	0.00031	32.1	C17orf99 Ig domain
8	PF11465 Receptor_2B4	4.6	18.9	Natural killer cell receptor 2B4
9	PF07686 V-set	0.22	23.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261520	0.696	Little elongation complex subunit 2
2	9606.ENSP00000379566	0.687	Coiled-coil alpha-helical rod protein 1
3	9606.ENSP00000362684	0.626	Protein FAM167B
4	9606.ENSP00000364978	0.574	Lymphocyte antigen 6 family member G6C
5	9606.ENSP00000221978	0.572	Protein NKG7
6	9606.ENSP00000216338	0.546	Granzyme H
7	9606.ENSP00000416750	0.525	Serine/threonine-protein kinase 33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.995	signaling receptor binding
GO:0019903	0.995	protein phosphatase binding
GO:0042287	0.983	MHC protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0050896	0.948	response to stimulus
GO:0002682	0.916	regulation of immune system process
GO:0002683	0.898	negative regulation of immune system process
GO:0048583	0.851	regulation of response to stimulus
GO:0048518	0.838	positive regulation of biological process
GO:0050776	0.821	regulation of immune response
GO:0019222	0.815	regulation of metabolic process
GO:0060255	0.775	regulation of macromolecule metabolic process
GO:0002697	0.742	regulation of immune effector process
GO:0002376	0.713	immune system process
GO:0032879	0.705	regulation of localization
GO:0048523	0.670	negative regulation of cellular process
GO:0051239	0.661	regulation of multicellular organismal process
GO:0050854	0.644	regulation of antigen receptor-mediated signaling pathway
GO:0051924	0.596	regulation of calcium ion transport
GO:0032501	0.551	multicellular organismal process
GO:0051716	0.493	cellular response to stimulus
GO:0023052	0.490	signaling
GO:0007154	0.486	cell communication
GO:0007165	0.484	signal transduction
GO:0048522	0.481	positive regulation of cellular process
GO:0002684	0.463	positive regulation of immune system process
GO:0009893	0.458	positive regulation of metabolic process
GO:0048585	0.430	negative regulation of response to stimulus
GO:0010468	0.429	regulation of gene expression
GO:0006950	0.408	response to stress
GO:0031323	0.391	regulation of cellular metabolic process
GO:0006952	0.345	defense response
GO:0002694	0.335	regulation of leukocyte activation
GO:0080090	0.313	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0009986	0.928	cell surface
GO:0098552	0.859	side of membrane
GO:0009897	0.832	external side of plasma membrane
GO:0043226	0.751	organelle
GO:0005737	0.737	cytoplasm
GO:0043231	0.727	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]