StarFunc result for job id Q6DN90

User Input

>input (963 residues)
MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEH
TSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQ
VEMLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFS
FEGPEKVHSSYFEGKQVSVTNDGSQLGALVSPECGDLSEPTTLKSPAPSSDFADAITELE
DAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTEPQTALHGMDHRKLDEMTASY
SDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSCR
STPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPKH
GPHSGAPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSN
DTINCSSESSSRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKPE
KGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFS
TMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAII
LLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPREMLMGIYERIRKRELKTNEDHVS
QVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFL
FNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVLI
NFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNG
TLSRACLDDSYASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPSV
LCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EZE5	0.549	0.432	0.000	1252	0.815	0.627	E7EZE5.pdb.gz	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
2	AFDB:Q3TES0	0.389	0.315	2.316E-58	1195	0.415	0.335	Q3TES0.pdb.gz	IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Iqsec3 PE=1 SV=1
3	PDB:6bbpA	0.205	0.365	2.101E-21	520	0.110	0.204	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
4	PDB:6u3eA	0.187	0.436	1.196E-20	397	0.109	0.264	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
5	AFDB:A0A2R8QD21	0.133	0.069	6.875E-10	1989	0.117	0.057	A0A2R8QD21.pdb.gz
6	AFDB:Q8IQ97	0.127	0.097	7.106E-9	1311	0.164	0.121	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
7	AFDB:Q8R4H2	0.129	0.085	3.002E-8	1543	0.154	0.096	Q8R4H2.pdb.gz	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
8	AFDB:P97433	0.128	0.078	1.473E-7	1693	0.145	0.083	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
9	PDB:4mt6A	0.134	0.297	8.159E-7	389	0.051	0.126	4mt6A.pdb.gz
10	AFDB:O94827	0.138	0.133	1.522E-6	1006	0.126	0.120	O94827.pdb.gz	PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5 PE=1 SV=4
11	AFDB:X2JC00	0.109	0.080	3.371E-6	1404	0.128	0.088	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
12	AFDB:P51862	0.120	0.088	3.315E-5	1356	0.118	0.084	P51862.pdb.gz	ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROM2 PE=1 SV=1
13	AFDB:Q9Y7U6	0.130	0.097	4.250E-5	1334	0.128	0.092	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
14	PDB:4gouA	0.123	0.203	2.873E-4	507	0.049	0.093	4gouA.pdb.gz
15	PDB:5yqrA	0.119	0.329	1.276E-3	268	0.026	0.093	5yqrA.pdb.gz
16	PDB:3pvuA	0.090	0.138	1.719E-3	609	0.036	0.057	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:3uzsA	0.086	0.129	4.644E-3	609	0.052	0.082	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
18	PDB:1k5dB	0.097	0.460	8.022E-3	146	0.020	0.130	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
19	PDB:6s9wA	0.095	0.208	1.255E-2	411	0.018	0.041	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:3m1iB	0.091	0.488	3.389E-2	131	0.010	0.076	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGT3	0.0	1674	814	0.842	0.996	A0A0C4DGT3_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
2	A0A0G2JZX5	0.0	979	1002	0.592	0.569	A0A0G2JZX5_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=1 SV=2
3	A0A2R8Y695	0.0	1551	779	0.782	0.967	A0A2R8Y695_HUMAN IQ motif and Sec7 domain ArfGEF 1 (Fragment) OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
4	A0A2R8Y7T6	0.0	1935	964	0.984	0.983	A0A2R8Y7T6_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
5	A0A3B3IRZ4	0.0	1899	1222	0.963	0.759	A0A3B3IRZ4_HUMAN IQ motif and Sec7 domain ArfGEF 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
6	A0A8I5Y7S8	0.0	979	1154	0.592	0.494	A0A8I5Y7S8_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
7	A0A8I6APH1	0.0	979	949	0.593	0.602	A0A8I6APH1_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
8	A0A8I6GKX8	0.0	998	1488	0.602	0.390	A0A8I6GKX8_RAT IQ motif and Sec7 domain ArfGEF 2 OS=Rattus norvegicus OX=10116 GN=Iqsec2 PE=3 SV=1
9	A4GZ26	0.0	972	1479	0.594	0.387	A4GZ26_MOUSE ARF6 guanine nucleotide exchange factor IQArfGEF OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=1
10	E7EZE5	0.0	1566	1252	0.815	0.627	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
11	Q5DU25	0.0	999	1478	0.603	0.393	IQEC2_MOUSE IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Iqsec2 PE=1 SV=3
12	Q5JU85	0.0	994	1488	0.600	0.388	IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2
13	Q6DN90	0.0	1981	963	1.000	1.000	IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=IQSEC1 PE=1 SV=1
14	Q76M68	0.0	560	1194	0.276	0.223	IQEC3_RAT IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Iqsec3 PE=1 SV=1
15	Q8R0S2	0.0	1791	961	0.956	0.958	IQEC1_MOUSE IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Iqsec1 PE=1 SV=2
16	Q9UPP2	0.0	559	1182	0.279	0.228	IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=IQSEC3 PE=2 SV=3
17	X1WBR0	0.0	1562	1134	0.814	0.691	X1WBR0_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X3 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=2
18	Q95U36	8.18e-156	489	1082	0.260	0.231	Q95U36_DROME GH10594p OS=Drosophila melanogaster OX=7227 GN=siz PE=2 SV=1
19	E1JI59	2.69e-155	491	1220	0.260	0.205	E1JI59_DROME Schizo, isoform D OS=Drosophila melanogaster OX=7227 GN=siz PE=1 SV=1
20	Q6U9V3	5.15e-155	491	1210	0.260	0.207	Q6U9V3_DROME Loner ISO3 OS=Drosophila melanogaster OX=7227 GN=siz PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	6.7e-64	225.3	PH domain
2	PF19057 PH_19	1.3e+02	13.7	PH domain
3	PF01369 Sec7	2.7e-58	208.2	Sec7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000025258

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000010720	0.912	ADP-ribosylation factor 6
2	9598.ENSPTRP00000003488	0.744	Belongs to the small GTPase superfamily. Arf family.
3	9598.ENSPTRP00000061256	0.744	ADP-ribosylation factor 1
4	9598.ENSPTRP00000032807	0.715	Receptor protein-tyrosine kinase
5	9598.ENSPTRP00000028407	0.702	Uncharacterized protein
6	9598.ENSPTRP00000028894	0.673	ADP-ribosylation factor-like 15
7	9598.ENSPTRP00000050914	0.660	Uncharacterized protein
8	9598.ENSPTRP00000060225	0.660	Uncharacterized protein
9	9598.ENSPTRP00000028112	0.654	Pro-epidermal growth factor
10	9598.ENSPTRP00000058347	0.624	Synaptic Ras GTPase activating protein 1
11	9598.ENSPTRP00000014780	0.623	Uncharacterized protein
12	9598.ENSPTRP00000033647	0.595	ADP-ribosylation factor 5
13	9598.ENSPTRP00000015508	0.556	Receptor protein-tyrosine kinase
14	9598.ENSPTRP00000050753	0.550	Transmembrane protein 236
15	9598.ENSPTRP00000025092	0.547	SH3 and multiple ankyrin repeat domains 3
16	9598.ENSPTRP00000040597	0.521	Carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
17	9598.ENSPTRP00000032600	0.514	Uncharacterized protein
18	9598.ENSPTRP00000032338	0.513	Missing oocyte, meiosis regulator, homolog
19	9598.ENSPTRP00000007621	0.510	Kirre like nephrin family adhesion molecule 3
20	9598.ENSPTRP00000043270	0.509	Myosin XVI

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.544	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0023051	0.955	regulation of signaling
GO:0010646	0.955	regulation of cell communication
GO:0032501	0.831	multicellular organismal process
GO:0065008	0.775	regulation of biological quality
GO:0099177	0.714	regulation of trans-synaptic signaling
GO:0009987	0.712	cellular process
GO:0048518	0.628	positive regulation of biological process
GO:0048522	0.619	positive regulation of cellular process
GO:0050804	0.416	modulation of chemical synaptic transmission
GO:0032502	0.366	developmental process
GO:0048856	0.362	anatomical structure development
GO:0007275	0.345	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.991	intracellular organelle lumen
GO:0005634	0.991	nucleus
GO:0031981	0.977	nuclear lumen
GO:0016020	0.940	membrane
GO:0005730	0.854	nucleolus
GO:0030054	0.744	cell junction
GO:0005737	0.676	cytoplasm
GO:0005886	0.356	plasma membrane
GO:0098590	0.335	plasma membrane region
GO:0098794	0.311	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]