StarFunc result for job id Q6E213

User Input

>input (333 residues)
MLLPSKKDLKTALDVFAVFQWSFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDW
KTPQRGGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHF
ATEASGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLTHKGTGNMV
IVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGG
FVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIV
AKYHTLYIDALRKLFDQHKTKFGISETQELEII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6E213	1.000	1.000	3.638E-73	333	1.000	1.000	Q6E213.pdb.gz	AWAT2_HUMAN Acyl-CoA wax alcohol acyltransferase 2 OS=Homo sapiens OX=9606 GN=AWAT2 PE=1 SV=1
2	AFDB:Q6E1M8	0.989	0.989	4.349E-65	333	0.844	0.844	Q6E1M8.pdb.gz	AWAT2_MOUSE Acyl-CoA wax alcohol acyltransferase 2 OS=Mus musculus OX=10090 GN=Awat2 PE=1 SV=1
3	AFDB:Q6ZPD8	0.954	0.943	3.670E-50	337	0.505	0.499	Q6ZPD8.pdb.gz	DG2L6_HUMAN Diacylglycerol O-acyltransferase 2-like protein 6 OS=Homo sapiens OX=9606 GN=DGAT2L6 PE=1 SV=1
4	AFDB:Q58HT5	0.923	0.937	1.509E-47	328	0.517	0.524	Q58HT5.pdb.gz	AWAT1_HUMAN Acyl-CoA wax alcohol acyltransferase 1 OS=Homo sapiens OX=9606 GN=AWAT1 PE=1 SV=1
5	AFDB:Q4V9F0	0.952	0.880	1.083E-45	361	0.453	0.418	Q4V9F0.pdb.gz	DGAT2_DANRE Diacylglycerol O-acyltransferase 2 OS=Danio rerio OX=7955 GN=dgat2 PE=2 SV=1
6	AFDB:Q5FVP8	0.944	0.813	1.378E-45	388	0.471	0.405	Q5FVP8.pdb.gz	DGAT2_RAT Diacylglycerol O-acyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Dgat2 PE=2 SV=1
7	AFDB:Q80W94	0.936	0.933	3.152E-44	334	0.417	0.416	Q80W94.pdb.gz	MOGT2_MOUSE 2-acylglycerol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Mogat2 PE=1 SV=1
8	AFDB:Q86VF5	0.926	0.905	2.591E-43	341	0.402	0.393	Q86VF5.pdb.gz	MOGT3_HUMAN 2-acylglycerol O-acyltransferase 3 OS=Homo sapiens OX=9606 GN=MOGAT3 PE=1 SV=1
9	AFDB:Q96PD6	0.943	0.938	1.778E-42	335	0.396	0.394	Q96PD6.pdb.gz	MOGT1_HUMAN 2-acylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=MOGAT1 PE=2 SV=2
10	AFDB:Q3SYC2	0.922	0.919	2.006E-42	334	0.423	0.422	Q3SYC2.pdb.gz	MOGT2_HUMAN 2-acylglycerol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=MOGAT2 PE=1 SV=2
11	PDB:3h5aC	0.118	0.114	4.605E-2	358	0.054	0.050	3h5aC.pdb.gz	How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
12	PDB:6xoiB	0.128	0.114	9.482E-2	403	0.063	0.052	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
13	PDB:3gwzA	0.204	0.201	1.445E-1	339	0.057	0.056	3gwzA.pdb.gz	Structural characterization of the mitomycin 7-O-methyltransferase.
14	PDB:5m58A	0.149	0.201	1.445E-1	230	0.039	0.057	5m58A.pdb.gz	Crystal Structure and Catalytic Mechanism of CouO, a Versatile C-Methyltransferase from Streptomyces rishiriensis.
15	PDB:6cwyD	0.141	0.106	1.535E-1	487	0.066	0.045	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.
16	PDB:7ezgA	0.143	0.160	1.731E-1	275	0.096	0.116	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
17	PDB:5wp5A	0.161	0.132	1.952E-1	463	0.054	0.039	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
18	PDB:5l6iA	0.140	0.056	2.484E-1	1007	0.042	0.014	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
19	PDB:6dc6C	0.128	0.060	2.484E-1	996	0.054	0.018	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
20	PDB:1y8rA	0.086	0.088	2.802E-1	314	0.057	0.061	1y8rA.pdb.gz	Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6E1M8	0.0	603	333	0.844	0.844	AWAT2_MOUSE Acyl-CoA wax alcohol acyltransferase 2 OS=Mus musculus OX=10090 GN=Awat2 PE=1 SV=1
2	Q6E213	0.0	689	333	1.000	1.000	AWAT2_HUMAN Acyl-CoA wax alcohol acyltransferase 2 OS=Homo sapiens OX=9606 GN=AWAT2 PE=1 SV=1
3	Q6ZPD8	7.67e-127	368	337	0.514	0.507	DG2L6_HUMAN Diacylglycerol O-acyltransferase 2-like protein 6 OS=Homo sapiens OX=9606 GN=DGAT2L6 PE=1 SV=1
4	Q96PD7	1.28e-120	354	388	0.483	0.415	DGAT2_HUMAN Diacylglycerol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=DGAT2 PE=1 SV=2
5	Q9DCV3	1.47e-119	351	388	0.480	0.412	DGAT2_MOUSE Diacylglycerol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Dgat2 PE=1 SV=1
6	Q70VZ8	1.73e-119	350	361	0.477	0.440	DGAT2_BOVIN Diacylglycerol O-acyltransferase 2 OS=Bos taurus OX=9913 GN=DGAT2 PE=2 SV=1
7	Q5FVP8	9.16e-119	349	388	0.474	0.407	DGAT2_RAT Diacylglycerol O-acyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Dgat2 PE=2 SV=1
8	Q58HT5	3.58e-117	343	328	0.511	0.518	AWAT1_HUMAN Acyl-CoA wax alcohol acyltransferase 1 OS=Homo sapiens OX=9606 GN=AWAT1 PE=1 SV=1
9	Q4V9F0	1.60e-109	325	361	0.462	0.427	DGAT2_DANRE Diacylglycerol O-acyltransferase 2 OS=Danio rerio OX=7955 GN=dgat2 PE=2 SV=1
10	Q86VF5	1.48e-97	293	341	0.405	0.396	MOGT3_HUMAN 2-acylglycerol O-acyltransferase 3 OS=Homo sapiens OX=9606 GN=MOGAT3 PE=1 SV=1
11	Q3SYC2	1.16e-92	281	334	0.420	0.419	MOGT2_HUMAN 2-acylglycerol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=MOGAT2 PE=1 SV=2
12	Q80W94	2.24e-92	280	334	0.420	0.419	MOGT2_MOUSE 2-acylglycerol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Mogat2 PE=1 SV=1
13	Q96PD6	2.64e-91	277	335	0.402	0.400	MOGT1_HUMAN 2-acylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=MOGAT1 PE=2 SV=2
14	Q91ZV4	1.28e-88	271	335	0.390	0.388	MOGT1_MOUSE 2-acylglycerol O-acyltransferase 1 OS=Mus musculus OX=10090 GN=Mogat1 PE=1 SV=2
15	F1R0E7	5.47e-87	268	368	0.378	0.342	F1R0E7_DANRE Acyltransferase OS=Danio rerio OX=7955 GN=wu:fb94h05 PE=1 SV=1
16	Q54GC1	3.36e-76	239	330	0.345	0.348	DGAT2_DICDI Diacylglycerol O-acyltransferase 2 OS=Dictyostelium discoideum OX=44689 GN=dgat2 PE=3 SV=1
17	Q23067	1.40e-70	225	359	0.348	0.323	Q23067_CAEEL Acyltransferase OS=Caenorhabditis elegans OX=6239 GN=dgtr-1 PE=3 SV=1
18	F1QSW7	2.45e-69	218	252	0.297	0.393	F1QSW7_DANRE 2-acylglycerol O-acyltransferase 2 isoform 2 OS=Danio rerio OX=7955 GN=wu:fb94h05 PE=1 SV=1
19	Q9XUW0	7.88e-69	220	345	0.348	0.336	Q9XUW0_CAEEL Acyltransferase OS=Caenorhabditis elegans OX=6239 GN=dgat-2 PE=1 SV=1
20	O74850	1.28e-65	212	345	0.351	0.339	DGAT2_SCHPO Diacylglycerol O-acyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dga1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	21	16.2	Acyltransferase
2	PF03982 DAGAT	1.6e-101	350.8	Diacylglycerol acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421172

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482264	0.928	Diacylglycerol O-acyltransferase 1
2	9606.ENSP00000268125	0.918	Retinaldehyde-binding protein 1
3	9606.ENSP00000262340	0.909	Retinoid isomerohydrolase
4	9606.ENSP00000326219	0.904	Dehydrogenase/reductase SDR family member 4
5	9606.ENSP00000370750	0.904	Retinol dehydrogenase 11
6	9606.ENSP00000240285	0.903	Retinol dehydrogenase 10
7	9606.ENSP00000295802	0.903	All-trans-retinol 13,14-reductase
8	9606.ENSP00000307607	0.903	Epidermal retinol dehydrogenase 2
9	9606.ENSP00000480439	0.903	Short-chain dehydrogenase/reductase 3
10	9606.ENSP00000224356	0.901	Cytochrome P450 26A1
11	9606.ENSP00000257895	0.900	11-cis retinol dehydrogenase
12	9606.ENSP00000334128	0.900	Cytochrome P450 27C1
13	9606.ENSP00000389241	0.900	Dehydrogenase/reductase SDR family member 9
14	9606.ENSP00000451406	0.900	17-beta-hydroxysteroid dehydrogenase type 6
15	9606.ENSP00000264832	0.830	Intercellular adhesion molecule 1
16	9606.ENSP00000355944	0.747	Kinetochore-associated protein NSL1 homolog
17	9606.ENSP00000219400	0.716	COX assembly mitochondrial protein 2 homolog
18	9606.ENSP00000429986	0.710	Transcription and mRNA export factor ENY2
19	9606.ENSP00000379934	0.669	Probable palmitoyltransferase ZDHHC4
20	9606.ENSP00000449079	0.666	Retinol dehydrogenase 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016411	1.000	acylglycerol O-acyltransferase activity
GO:0004144	0.988	diacylglycerol O-acyltransferase activity
GO:0003846	0.795	2-acylglycerol O-acyltransferase activity
GO:0005488	0.440	binding
GO:0005515	0.432	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901568	0.995	fatty acid derivative metabolic process
GO:0044255	0.989	cellular lipid metabolic process
GO:0008610	0.986	lipid biosynthetic process
GO:1901570	0.981	fatty acid derivative biosynthetic process
GO:0006720	0.938	isoprenoid metabolic process
GO:0016101	0.932	diterpenoid metabolic process
GO:0046463	0.932	acylglycerol biosynthetic process
GO:0001523	0.817	retinoid metabolic process
GO:0044281	0.361	small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:10868	0.988	a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA
EC:2.3.1.20	0.988	diacylglycerol O-acyltransferase.
RHEA:16741	0.795	a 2-acylglycerol + an acyl-CoA = a 1,2-diacylglycerol + CoA
EC:2.3.1.22	0.795	2-acylglycerol O-acyltransferase.

[back to server]