StarFunc result for job id Q6EBC2

User Input

>input (164 residues)
MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEK
GVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAP
ETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6EBC2	1.000	1.000	6.068E-24	164	1.000	1.000	Q6EBC2.pdb.gz	IL31_HUMAN Interleukin-31 OS=Homo sapiens OX=9606 GN=IL31 PE=1 SV=1
2	AFDB:Q6EAL8	0.599	0.602	1.531E-5	163	0.287	0.288	Q6EAL8.pdb.gz	IL31_MOUSE Interleukin-31 OS=Mus musculus OX=10090 GN=Il31 PE=2 SV=1
3	AFDB:A0A0R4IFC8	0.488	0.399	5.878E-3	217	0.171	0.129	A0A0R4IFC8.pdb.gz
4	AFDB:P09586	0.500	0.394	8.860E-3	222	0.159	0.117	P09586.pdb.gz	PR3B1_MOUSE Prolactin-3B1 OS=Mus musculus OX=10090 GN=Prl3b1 PE=1 SV=1
5	PDB:1z7cA	0.356	0.362	1.263E-2	161	0.140	0.143	1z7cA.pdb.gz
6	AFDB:W5PH94	0.457	0.343	1.336E-2	231	0.165	0.117	W5PH94.pdb.gz	W5PH94_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
7	AFDB:P47873	0.565	0.479	2.883E-2	199	0.122	0.101	P47873.pdb.gz	IL11_MOUSE Interleukin-11 OS=Mus musculus OX=10090 GN=Il11 PE=1 SV=1
8	AFDB:P06879	0.387	0.303	3.035E-2	226	0.159	0.115	P06879.pdb.gz	PRL_MOUSE Prolactin OS=Mus musculus OX=10090 GN=Prl PE=2 SV=1
9	AFDB:E5RWR3	0.390	0.300	4.575E-2	229	0.177	0.127	E5RWR3.pdb.gz	E5RWR3_MELGA Prolactin OS=Meleagris gallopavo OX=9103 GN=PRL PE=3 SV=1
10	AFDB:P69130	0.435	0.351	4.815E-2	211	0.171	0.133	P69130.pdb.gz	PRL1_ONCKE Prolactin-1 OS=Oncorhynchus keta OX=8018 GN=prl1 PE=1 SV=1
11	AFDB:P20809	0.506	0.431	5.069E-2	199	0.159	0.131	P20809.pdb.gz	IL11_HUMAN Interleukin-11 OS=Homo sapiens OX=9606 GN=IL11 PE=1 SV=1
12	PDB:6o4oA	0.570	0.555	5.590E-2	169	0.122	0.118	6o4oA.pdb.gz
13	PDB:1bp3A	0.386	0.349	1.819E-1	186	0.140	0.124	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
14	PDB:1f6fA	0.427	0.386	1.819E-1	183	0.104	0.093	1f6fA.pdb.gz
15	PDB:5mj4B	0.353	0.356	2.886E-1	162	0.104	0.105	5mj4B.pdb.gz
16	PDB:1cnt2	0.459	0.560	3.198E-1	130	0.104	0.131	1cnt2.pdb.gz
17	PDB:1ax8A	0.422	0.506	3.730E-1	130	0.104	0.131	1ax8A.pdb.gz
18	PDB:3hmxB	0.422	0.399	3.926E-1	176	0.116	0.108	3hmxB.pdb.gz
19	PDB:4cniC	0.458	0.443	4.350E-1	171	0.177	0.170	4cniC.pdb.gz
20	PDB:7zxkC	0.308	0.306	4.579E-1	166	0.128	0.127	7zxkC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6EBC2	2.25e-120	338	164	1.000	1.000	IL31_HUMAN Interleukin-31 OS=Homo sapiens OX=9606 GN=IL31 PE=1 SV=1
2	Q6EAL8	2.75e-16	73.6	163	0.287	0.288	IL31_MOUSE Interleukin-31 OS=Mus musculus OX=10090 GN=Il31 PE=2 SV=1
3	O44754	0.084	35.0	548	0.146	0.044	O44754_CAEEL CILiary localization OS=Caenorhabditis elegans OX=6239 GN=cil-7 PE=4 SV=2
4	Q557G4	3.9	30.0	332	0.091	0.045	Y3449_DICDI Uncharacterized protein DDB_G0273449/DDB_G0273577 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273449 PE=2 SV=1
5	Q1KMS5	5.3	29.6	1242	0.067	0.009	Q1KMS5_DANRE Nephrin OS=Danio rerio OX=7955 GN=nphs1l PE=2 SV=1
6	Q9S7Y1	5.6	29.6	368	0.134	0.060	BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis thaliana OX=3702 GN=BHLH30 PE=1 SV=1
7	Q8N2H3	6.3	29.6	581	0.122	0.034	PYRD2_HUMAN Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PYROXD2 PE=1 SV=2
8	Q9LM20	7.1	29.3	515	0.104	0.033	PUM8_ARATH Putative pumilio homolog 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APUM8 PE=3 SV=2
9	C6KSM4	8.1	29.3	937	0.177	0.031	C6KSM4_PLAF7 Elongation factor G OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0602400 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15209 IL31	4.5e-52	186.7	Interleukin 31

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366234

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415900	0.994	Interleukin-31 receptor subunit alpha
2	9606.ENSP00000274276	0.983	Oncostatin-M-specific receptor subunit beta
3	9606.ENSP00000343204	0.756	Tyrosine-protein kinase JAK1
4	9606.ENSP00000304915	0.707	Interleukin-13
5	9606.ENSP00000370842	0.704	Interleukin-33
6	9606.ENSP00000339804	0.689	Thymic stromal lymphopoietin
7	9606.ENSP00000231449	0.681	Interleukin-4
8	9606.ENSP00000231454	0.666	Interleukin-5
9	9606.ENSP00000442424	0.656	Interleukin-22
10	9606.ENSP00000357789	0.653	Filaggrin
11	9606.ENSP00000344192	0.651	Interleukin-17A
12	9606.ENSP00000215781	0.643	Oncostatin-M
13	9606.ENSP00000274520	0.615	Interleukin-9
14	9606.ENSP00000385675	0.602	Interleukin-6
15	9606.ENSP00000337432	0.595	Interleukin-17F
16	9606.ENSP00000279804	0.567	Cardiotrophin-1
17	9606.ENSP00000264563	0.565	Interleukin-11
18	9606.ENSP00000256906	0.561	Histamine H4 receptor
19	9606.ENSP00000412237	0.559	Interleukin-10
20	9606.ENSP00000398698	0.526	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.660	signaling receptor binding
GO:0098772	0.537	molecular function regulator activity
GO:0048018	0.487	receptor ligand activity
GO:0005126	0.475	cytokine receptor binding
GO:0005125	0.450	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050896	0.954	response to stimulus
GO:0032501	0.948	multicellular organismal process
GO:0048856	0.948	anatomical structure development
GO:0050789	0.898	regulation of biological process
GO:0030154	0.897	cell differentiation
GO:0050794	0.877	regulation of cellular process
GO:0051716	0.829	cellular response to stimulus
GO:0048518	0.802	positive regulation of biological process
GO:0042221	0.798	response to chemical
GO:0048468	0.778	cell development
GO:0002376	0.766	immune system process
GO:0006950	0.720	response to stress
GO:0048522	0.718	positive regulation of cellular process
GO:0007154	0.689	cell communication
GO:0023052	0.688	signaling
GO:0009605	0.677	response to external stimulus
GO:0019222	0.621	regulation of metabolic process
GO:0007165	0.605	signal transduction
GO:0060255	0.597	regulation of macromolecule metabolic process
GO:0010033	0.545	response to organic substance
GO:0009893	0.543	positive regulation of metabolic process
GO:0010604	0.513	positive regulation of macromolecule metabolic process
GO:0070887	0.494	cellular response to chemical stimulus
GO:0080090	0.425	regulation of primary metabolic process
GO:0051171	0.418	regulation of nitrogen compound metabolic process
GO:0034097	0.417	response to cytokine
GO:0031323	0.409	regulation of cellular metabolic process
GO:0010468	0.374	regulation of gene expression
GO:0048519	0.370	negative regulation of biological process
GO:0051246	0.364	regulation of protein metabolic process
GO:0007275	0.341	multicellular organism development
GO:0031325	0.337	positive regulation of cellular metabolic process
GO:0051239	0.320	regulation of multicellular organismal process
GO:0051173	0.317	positive regulation of nitrogen compound metabolic process
GO:0043207	0.311	response to external biotic stimulus
GO:0006955	0.308	immune response
GO:0048523	0.305	negative regulation of cellular process
GO:0051174	0.305	regulation of phosphorus metabolic process
GO:0019220	0.303	regulation of phosphate metabolic process
GO:0006952	0.301	defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]