StarFunc result for job id Q6EIG7

User Input

>input (209 residues)
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSY
HSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTE
AEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIV
FWKPTGWGWNDVICETRRNSICEMNKIYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6EIG7	1.000	1.000	4.956E-39	209	1.000	1.000	Q6EIG7.pdb.gz	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
2	AFDB:Q9JKF4	0.909	0.909	1.678E-29	209	0.689	0.689	Q9JKF4.pdb.gz	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
3	AFDB:Q8WTT0	0.741	0.728	1.910E-25	213	0.550	0.540	Q8WTT0.pdb.gz	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
4	AFDB:Q67DU8	0.873	0.877	2.541E-24	208	0.526	0.529	Q67DU8.pdb.gz	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
5	AFDB:Q7TS58	0.726	0.726	1.721E-23	209	0.493	0.493	Q7TS58.pdb.gz	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
6	AFDB:Q9UMR7	0.714	0.631	5.958E-22	237	0.402	0.354	Q9UMR7.pdb.gz	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
7	AFDB:Q5YIR8	0.724	0.644	1.386E-21	236	0.407	0.360	Q5YIR8.pdb.gz	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1
8	AFDB:Q9QZ15	0.711	0.627	7.084E-21	238	0.392	0.345	Q9QZ15.pdb.gz	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
9	AFDB:Q69FH1	0.657	0.632	1.647E-20	218	0.416	0.399	Q69FH1.pdb.gz	CLC4D_RAT C-type lectin domain family 4 member D OS=Rattus norvegicus OX=10116 GN=Clec4d PE=1 SV=1
10	AFDB:Q8WXI8	0.682	0.664	2.063E-20	215	0.411	0.400	Q8WXI8.pdb.gz	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
11	PDB:7wz8A	0.536	0.618	1.833E-10	180	0.234	0.272	7wz8A.pdb.gz
12	PDB:1qddA	0.540	0.770	1.939E-10	144	0.177	0.257	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:5f2qB	0.545	0.825	5.068E-9	135	0.167	0.259	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:4mthA	0.507	0.739	1.395E-8	139	0.177	0.266	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:1htnA	0.531	0.702	7.546E-8	156	0.115	0.154	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
16	PDB:1gz2A	0.510	0.746	1.119E-7	139	0.163	0.245	1gz2A.pdb.gz
17	PDB:2kv3A	0.494	0.744	2.198E-7	131	0.177	0.282	2kv3A.pdb.gz
18	PDB:7qsrA	0.507	0.086	2.198E-7	1335	0.153	0.024	7qsrA.pdb.gz
19	PDB:1bj3B	0.408	0.664	2.912E-7	123	0.167	0.285	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
20	PDB:1bj3A	0.428	0.674	5.407E-7	129	0.167	0.271	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6EIG7	6.40e-157	434	209	1.000	1.000	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
2	Q9JKF4	3.56e-102	295	209	0.689	0.689	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
3	Q8WTT0	7.86e-79	236	213	0.550	0.540	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
4	Q67DU8	2.56e-73	222	208	0.536	0.538	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
5	Q7TS58	8.54e-71	216	209	0.526	0.526	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
6	Q69FH1	1.06e-54	175	218	0.407	0.390	CLC4D_RAT C-type lectin domain family 4 member D OS=Rattus norvegicus OX=10116 GN=Clec4d PE=1 SV=1
7	Q9UMR7	3.95e-52	169	237	0.383	0.338	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
8	Q9D8Q7	5.69e-52	167	176	0.431	0.511	Q9D8Q7_MOUSE C-type lectin domain family 4, member b1 OS=Mus musculus OX=10090 GN=Clec4b1 PE=1 SV=1
9	Q8WXI8	1.91e-51	167	215	0.402	0.391	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
10	Q9Z2H6	1.52e-50	165	219	0.383	0.365	CLC4D_MOUSE C-type lectin domain family 4 member D OS=Mus musculus OX=10090 GN=Clec4d PE=1 SV=1
11	Q5YIR8	1.50e-47	157	236	0.368	0.326	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1
12	Q9QZ15	8.72e-46	153	238	0.344	0.303	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
13	Q9ULY5	5.46e-44	148	219	0.407	0.388	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
14	Q67EQ1	1.99e-41	141	215	0.364	0.353	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
15	Q9R0Q8	4.48e-39	135	214	0.368	0.360	CLC4E_MOUSE C-type lectin domain family 4 member E OS=Mus musculus OX=10090 GN=Clec4e PE=1 SV=1
16	Q5KU26	8.01e-22	94.7	742	0.234	0.066	COL12_HUMAN Collectin-12 OS=Homo sapiens OX=9606 GN=COLEC12 PE=1 SV=3
17	L0N7P8	1.89e-21	89.7	216	0.273	0.264	L0N7P8_ONCMY CD209 antigen-like protein A OS=Oncorhynchus mykiss OX=8022 GN=cd209A PE=2 SV=1
18	P24721	1.16e-20	89.4	301	0.234	0.163	ASGR2_MOUSE Asialoglycoprotein receptor 2 OS=Mus musculus OX=10090 GN=Asgr2 PE=1 SV=1
19	Q91ZW8	7.56e-20	86.3	237	0.211	0.186	C209D_MOUSE CD209 antigen-like protein D OS=Mus musculus OX=10090 GN=Cd209d PE=2 SV=1
20	Q9H2X3	1.18e-19	87.8	399	0.239	0.125	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	5.1e-18	77.1	Lectin C-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371505

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.976	Tyrosine-protein kinase SYK
2	9606.ENSP00000289902	0.950	High affinity immunoglobulin epsilon receptor subunit gamma
3	9606.ENSP00000428924	0.917	Tyrosine-protein kinase Lyn
4	9606.ENSP00000346671	0.903	Tyrosine-protein kinase Fyn
5	9606.ENSP00000360797	0.863	Caspase recruitment domain-containing protein 9
6	9606.ENSP00000264122	0.802	E3 ubiquitin-protein ligase CBL-B
7	9606.ENSP00000347916	0.743	C-type lectin domain family 12 member A
8	9606.ENSP00000482457	0.742	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
9	9606.ENSP00000260010	0.697	Toll-like receptor 2
10	9606.ENSP00000299663	0.692	C-type lectin domain family 4 member E
11	9606.ENSP00000359612	0.681	B-cell lymphoma/leukemia 10
12	9606.ENSP00000363089	0.641	Toll-like receptor 4
13	9606.ENSP00000319279	0.605	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
14	9606.ENSP00000300589	0.566	Nucleotide-binding oligomerization domain-containing protein 2
15	9606.ENSP00000263341	0.565	Interleukin-1 beta
16	9606.ENSP00000160262	0.561	Intercellular adhesion molecule 3
17	9606.ENSP00000312082	0.549	Toll-like receptor 8
18	9606.ENSP00000398698	0.536	Tumor necrosis factor
19	9606.ENSP00000262629	0.535	TYRO protein tyrosine kinase-binding protein
20	9606.ENSP00000337432	0.535	Interleukin-17F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030246	1.000	carbohydrate binding
GO:0005515	1.000	protein binding
GO:0038187	0.999	pattern recognition receptor activity
GO:0048029	0.949	monosaccharide binding
GO:0005537	0.628	mannose binding
GO:0043167	0.395	ion binding
GO:0005102	0.321	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0048518	0.987	positive regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.967	cellular process
GO:0002682	0.955	regulation of immune system process
GO:0048583	0.912	regulation of response to stimulus
GO:0007165	0.878	signal transduction
GO:0048584	0.876	positive regulation of response to stimulus
GO:0009893	0.875	positive regulation of metabolic process
GO:0010604	0.872	positive regulation of macromolecule metabolic process
GO:0010468	0.869	regulation of gene expression
GO:0051239	0.867	regulation of multicellular organismal process
GO:0051240	0.841	positive regulation of multicellular organismal process
GO:0048522	0.826	positive regulation of cellular process
GO:0002376	0.806	immune system process
GO:0002684	0.806	positive regulation of immune system process
GO:0050776	0.788	regulation of immune response
GO:0009607	0.783	response to biotic stimulus
GO:0032101	0.781	regulation of response to external stimulus
GO:0080134	0.777	regulation of response to stress
GO:0006950	0.774	response to stress
GO:0009605	0.767	response to external stimulus
GO:0001817	0.748	regulation of cytokine production
GO:0031347	0.741	regulation of defense response
GO:0010628	0.733	positive regulation of gene expression
GO:0009966	0.729	regulation of signal transduction
GO:0006952	0.710	defense response
GO:0044419	0.690	biological process involved in interspecies interaction between organisms
GO:0050778	0.682	positive regulation of immune response
GO:0032103	0.648	positive regulation of response to external stimulus
GO:0002764	0.616	immune response-regulating signaling pathway
GO:0051707	0.611	response to other organism
GO:0002833	0.587	positive regulation of response to biotic stimulus
GO:0031349	0.580	positive regulation of defense response
GO:0045088	0.564	regulation of innate immune response
GO:0001819	0.561	positive regulation of cytokine production
GO:0045089	0.547	positive regulation of innate immune response
GO:0007166	0.534	cell surface receptor signaling pathway
GO:0080090	0.523	regulation of primary metabolic process
GO:0002253	0.523	activation of immune response
GO:0006955	0.502	immune response
GO:0032501	0.501	multicellular organismal process
GO:0051171	0.478	regulation of nitrogen compound metabolic process
GO:1902533	0.478	positive regulation of intracellular signal transduction
GO:0002757	0.476	immune response-activating signaling pathway
GO:0031323	0.452	regulation of cellular metabolic process
GO:0098542	0.447	defense response to other organism
GO:0002758	0.395	innate immune response-activating signaling pathway
GO:0051173	0.381	positive regulation of nitrogen compound metabolic process
GO:0051246	0.378	regulation of protein metabolic process
GO:0032502	0.372	developmental process
GO:0045087	0.366	innate immune response
GO:0031325	0.364	positive regulation of cellular metabolic process
GO:0048856	0.362	anatomical structure development
GO:0051247	0.333	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.840	intracellular anatomical structure
GO:0043231	0.774	intracellular membrane-bounded organelle
GO:0005737	0.766	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]