StarFunc result for job id Q6EMB2

User Input

>input (1281 residues)
MPIVMARDLEETASSSEDEEVISQEDHPCIMWTGGCRRIPVLVFHADAILTKDNNIRVIG
ERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKPFLLRTLSEAQKVN
HFPRSYELTRKDRLYKNIIRMQHTHGFKAFHILPQTFLLPAEYAEFCNSYSKDRGPWIVK
PVASSRGRGVYLINNPNQISLEENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYL
YEEGLARFATVRYDQGAKNIRNQFMHLTNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAML
RYLKQEGRDTTALMAHVEDLIIKTIISAELAIATACKTFVPHRSSCFELYGFDVLIDSTL
KPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRASTRPIYPTFESSRR
NPFQKPQRCRPLSASDAEMKNLVGSAREKGPGKLGGSVLGLSMEEIKVLRRVKEENDRRG
GFIRIFPTSETWEIYGSYLEHKTSMNYMLATRLFQDRMTADGAPELKIESLNSKAKLHAA
LYERKLLSLEVRKRRRRSSRLRAMRPKYPVITQPAEMNVKTETESEEEEEVALDNEDEEQ
EASQEESAGFLRENQAKYTPSLTALVENTPKENSMKVREWNNKGGHCCKLETQELEPKFN
LMQILQDNGNLSKMQARIAFSAYLQHVQIRLMKDSGGQTFSASWAAKEDEQMELVVRFLK
RASNNLQHSLRMVLPSRRLALLERRRILAHQLGDFIIVYNKETEQMAEKKSKKKVEEEEE
DGVNMENFQEFIRQASEAELEEVLTFYTQKNKSASVFLGTHSKISKNNNNYSDSGAKGDH
PETIMEEVKIKPPKQQQTTEIHSDKLSRFTTSAEKEAKLVYSNSSSGPTATLQKIPNTHL
SSVTTSDLSPGPCHHSSLSQIPSAIPSMPHQPTILLNTVSASASPCLHPGAQNIPSPTGL
PRCRSGSHTIGPFSSFQSAAHIYSQKLSRPSSAKAGSCYLNKHHSGIAKTQKEGEDASLY
SKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLR
PIISPSGPTWSTQSDPQAPENHSSSPGSRSLQTGGFAWEGEVENNVYSQATGVVPQHKYH
PTAGSYQLQFALQQLEQQKLQSRQLLDQSRARHQAIFGSQTLPNSNLWTMNNGAGCRISS
ATASGQKPTTLPQKVVPPPSSCASLVPKPPPNHEQVLRRATSQKASKGSSAEGQLNGLQS
SLNPAAFVPITSSTDPAHTKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6EMB2	1.000	1.000	0.000	1281	1.000	1.000	Q6EMB2.pdb.gz	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
2	AFDB:Q8CHB8	0.634	0.614	0.000	1328	0.884	0.852	Q8CHB8.pdb.gz	TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3
3	AFDB:Q9VBX5	0.337	0.466	8.123E-53	917	0.215	0.300	Q9VBX5.pdb.gz	Q9VBX5_DROME LD39904p OS=Drosophila melanogaster OX=7227 GN=TTLL5 PE=2 SV=1
4	AFDB:Q80UG8	0.317	0.340	1.915E-33	1193	0.157	0.168	Q80UG8.pdb.gz	TTLL4_MOUSE Tubulin monoglutamylase TTLL4 OS=Mus musculus OX=10090 GN=Ttll4 PE=1 SV=3
5	AFDB:Q14679	0.320	0.342	3.084E-33	1199	0.163	0.174	Q14679.pdb.gz	TTLL4_HUMAN Tubulin monoglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2
6	AFDB:A8CVX7	0.283	0.458	1.210E-31	778	0.158	0.261	A8CVX7.pdb.gz	TTLL6_DANRE Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1
7	AFDB:Q8N841	0.289	0.433	8.020E-30	843	0.156	0.237	Q8N841.pdb.gz	TTLL6_HUMAN Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2
8	PDB:8asnG	0.222	0.764	1.337E-16	346	0.069	0.257	8asnG.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
9	PDB:8asnF	0.204	0.768	8.728E-14	317	0.062	0.249	8asnF.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
10	PDB:3lwbB	0.158	0.554	6.395E-6	298	0.034	0.148	3lwbB.pdb.gz
11	PDB:3vpbB	0.141	0.506	7.377E-6	282	0.037	0.167	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
12	PDB:4c5aA	0.160	0.531	2.938E-5	306	0.040	0.167	4c5aA.pdb.gz	Inhibition of D-Ala:D-Ala ligase through a phosphorylated form of the antibiotic D-cycloserine.
13	PDB:1e4eA	0.123	0.355	4.102E-5	341	0.030	0.114	1e4eA.pdb.gz	The molecular basis of vancomycin resistance in clinically relevant Enterococci: crystal structure of D-alanyl-D-lactate ligase (VanA).
14	PDB:1b6sB	0.129	0.364	5.206E-5	355	0.035	0.127	1b6sB.pdb.gz	Three-dimensional structure of N5-carboxyaminoimidazole ribonucleotide synthetase: a member of the ATP grasp protein superfamily.
15	PDB:4fu0A	0.147	0.470	5.460E-5	343	0.030	0.111	4fu0A.pdb.gz	Structural and functional characterization of VanG D-Ala:D-Ser ligase associated with vancomycin resistance in Enterococcus faecalis
16	PDB:5douD	0.119	0.108	6.929E-5	1430	0.031	0.028	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
17	PDB:6jilB	0.145	0.466	8.384E-5	298	0.029	0.124	6jilB.pdb.gz	Cyclization mechanism catalyzed by an ATP-grasp enzyme essential for d-cycloserine biosynthesis.
18	AFDB:Q6S002	0.056	0.057	9.158E-4	1238	0.101	0.105	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
19	AFDB:Q9ESU6	0.045	0.044	5.341E-3	1400	0.095	0.087	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
20	AFDB:Q9BIW6	0.046	0.071	3.593E-2	749	0.087	0.148	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V2J9	0.0	2590	1281	0.973	0.973	G3V2J9_HUMAN Tubulin tyrosine ligase like 5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=1
2	G3V4R8	0.0	1516	775	0.579	0.957	G3V4R8_HUMAN Tubulin tyrosine ligase like 5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=1
3	Q6EMB2	0.0	2673	1281	1.000	1.000	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
4	Q8CHB8	0.0	2161	1328	0.884	0.852	TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3
5	Q9VBX5	9.77e-140	451	917	0.171	0.239	Q9VBX5_DROME LD39904p OS=Drosophila melanogaster OX=7227 GN=TTLL5 PE=2 SV=1
6	E9P886	4.82e-102	343	730	0.145	0.255	TTLL5_CAEEL Tubulin polyglutamylase ttll-5 OS=Caenorhabditis elegans OX=6239 GN=ttll-5 PE=2 SV=1
7	Q80UG8	5.25e-85	305	1193	0.130	0.139	TTLL4_MOUSE Tubulin monoglutamylase TTLL4 OS=Mus musculus OX=10090 GN=Ttll4 PE=1 SV=3
8	Q14679	1.69e-81	294	1199	0.129	0.138	TTLL4_HUMAN Tubulin monoglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2
9	Q23MT7	2.77e-72	266	1195	0.121	0.130	TTL6A_TETTS Probable beta-tubulin polyglutamylase OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=Ttll6a PE=3 SV=2
10	Q8IGW4	2.57e-70	255	828	0.100	0.155	Q8IGW4_DROME RE12363p OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=2 SV=1
11	Q9VKL9	2.59e-70	255	828	0.100	0.155	Q9VKL9_DROME Tubulin tyrosine ligase-like 4A, isoform E OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
12	M9NCT3	3.32e-70	255	827	0.100	0.155	M9NCT3_DROME Tubulin tyrosine ligase-like 4A, isoform K OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=1
13	Q8IPB2	1.88e-69	256	1071	0.100	0.120	Q8IPB2_DROME Tubulin tyrosine ligase-like 4A, isoform D OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
14	M9NEE5	2.73e-69	256	1070	0.100	0.120	M9NEE5_DROME Tubulin tyrosine ligase-like 4A, isoform I OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=1
15	A8CVX7	5.38e-67	244	778	0.119	0.197	TTLL6_DANRE Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1
16	A4Q9E8	3.20e-64	237	822	0.102	0.159	TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=10090 GN=Ttll6 PE=1 SV=1
17	Q09647	1.01e-62	228	601	0.112	0.240	TTLL4_CAEEL Tubulin polyglutamylase ttll-4 OS=Caenorhabditis elegans OX=6239 GN=ttll-4 PE=1 SV=3
18	Q8N841	9.92e-61	227	843	0.097	0.147	TTLL6_HUMAN Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2
19	A6NNM8	5.88e-59	221	815	0.103	0.162	TTL13_HUMAN Tubulin polyglutamylase TTLL13 OS=Homo sapiens OX=9606 GN=TTLL13 PE=1 SV=2
20	A4Q9F6	6.09e-59	221	804	0.106	0.169	TTL13_MOUSE Tubulin polyglutamylase TTLL13 OS=Mus musculus OX=10090 GN=Ttll13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14397 ATPgrasp_ST	7.8	17.2	Sugar-transfer associated ATP-grasp
2	PF14398 ATPgrasp_YheCD	0.0022	28.9	YheC/D like ATP-grasp
3	PF03133 TTL	1.7e-88	308.2	Tubulin-tyrosine ligase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295124	0.749	Coiled-coil domain containing 138
2	9606.ENSP00000286692	0.740	DNA damage-regulated autophagy modulator protein 2
3	9606.ENSP00000293879	0.737	WD repeat-containing protein 90
4	9606.ENSP00000280020	0.732	Protein hinderin
5	9606.ENSP00000361458	0.726	TSC22 domain family protein 3
6	9606.ENSP00000471454	0.724	Coiled-coil domain containing 61
7	9606.ENSP00000317144	0.710	Progesterone-induced-blocking factor 1
8	9606.ENSP00000286371	0.687	Sodium/potassium-transporting ATPase subunit beta-3
9	9606.ENSP00000263918	0.682	Striatin
10	9606.ENSP00000360905	0.681	Cytosolic carboxypeptidase 6
11	9606.ENSP00000370737	0.679	Glycine dehydrogenase (decarboxylating), mitochondrial
12	9606.ENSP00000352208	0.678	Myoferlin
13	9606.ENSP00000462729	0.672	OTU domain-containing protein 7B
14	9606.ENSP00000363869	0.665	V-set and immunoglobulin domain-containing protein 4
15	9606.ENSP00000398523	0.658	Calcium-binding and coiled-coil domain-containing protein 2
16	9606.ENSP00000387365	0.656	Periodic tryptophan protein 1 homolog
17	9606.ENSP00000415556	0.654	DDB1- and CUL4-associated factor 11
18	9606.ENSP00000479598	0.648	RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
19	9606.ENSP00000242465	0.646	Serglycin
20	9606.ENSP00000298248	0.640	Lambda-crystallin homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070740	1.000	tubulin-glutamic acid ligase activity
GO:0005488	0.432	binding
GO:0005515	0.400	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0036211	0.990	protein modification process
GO:0032502	0.979	developmental process
GO:0018200	0.970	peptidyl-glutamic acid modification
GO:0032501	0.951	multicellular organismal process
GO:0048856	0.909	anatomical structure development
GO:0009987	0.833	cellular process
GO:0007275	0.322	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005829	0.997	cytosol
GO:0015630	0.995	microtubule cytoskeleton
GO:0043227	0.994	membrane-bounded organelle
GO:0071944	0.990	cell periphery
GO:0005815	0.989	microtubule organizing center
GO:0005886	0.974	plasma membrane
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0042995	0.716	cell projection
GO:0120025	0.713	plasma membrane bounded cell projection
GO:0005929	0.698	cilium
GO:0005813	0.496	centrosome
GO:0036064	0.356	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.3.2.61	1.000	tubulin-glutamate ligase.

[back to server]