StarFunc result for job id Q6EMK4

User Input

>input (673 residues)
MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVF
ENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETF
RGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNS
LLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRG
LTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALPGDLSGLFPRLRLLAAARNPF
NCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPT
TRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQPQDCPPSTCLNGGTC
HLGTRHHLACLCPEGFTGLYCESQMGQGTRPSPTPVTPRPPRSLTLGIEPVSPTSLRVGL
QRYLQGSSVQLRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCVMPLGP
GRVPEGEEACGEAHTPPAVHSNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVR
RGRAMAAAAQDKGQVGPGAGPLELEGVKVPLEPGPKATEGGGEALPSGSECEVPLMGFPG
PGLQSPLHAKPYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6EMK4	0.999	0.999	0.000	673	1.000	1.000	Q6EMK4.pdb.gz	VASN_HUMAN Vasorin OS=Homo sapiens OX=9606 GN=VASN PE=1 SV=1
2	AFDB:Q9CZT5	0.716	0.716	6.245E-89	673	0.834	0.834	Q9CZT5.pdb.gz	VASN_MOUSE Vasorin OS=Mus musculus OX=10090 GN=Vasn PE=2 SV=2
3	AFDB:A8DZ86	0.519	0.508	4.561E-56	688	0.410	0.401	A8DZ86.pdb.gz	A8DZ86_DANRE Vasorin a OS=Danio rerio OX=7955 GN=id:ibd2098 PE=1 SV=1
4	AFDB:Q7L0X0	0.393	0.335	2.401E-28	811	0.294	0.244	Q7L0X0.pdb.gz	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
5	AFDB:O43155	0.433	0.441	3.676E-27	660	0.224	0.229	O43155.pdb.gz	FLRT2_HUMAN Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens OX=9606 GN=FLRT2 PE=1 SV=1
6	AFDB:Q70AK3	0.431	0.446	6.282E-27	648	0.232	0.241	Q70AK3.pdb.gz	FLRT3_XENLA Leucine-rich repeat transmembrane protein FLRT3 OS=Xenopus laevis OX=8355 GN=flrt3 PE=1 SV=2
7	AFDB:Q6RKD8	0.439	0.456	7.634E-27	646	0.205	0.214	Q6RKD8.pdb.gz	FLRT1_MOUSE Leucine-rich repeat transmembrane protein FLRT1 OS=Mus musculus OX=10090 GN=Flrt1 PE=1 SV=2
8	AFDB:B1H234	0.416	0.431	1.023E-26	649	0.208	0.216	B1H234.pdb.gz	FLRT3_RAT Leucine-rich repeat transmembrane protein FLRT3 OS=Rattus norvegicus OX=10116 GN=Flrt3 PE=1 SV=1
9	AFDB:B8A507	0.433	0.448	2.341E-26	649	0.226	0.234	B8A507.pdb.gz	B8A507_DANRE Fibronectin leucine-rich transmembrane 3 OS=Danio rerio OX=7955 GN=fb93g11 PE=1 SV=1
10	AFDB:F1QF54	0.428	0.405	2.710E-26	715	0.224	0.211	F1QF54.pdb.gz	F1QF54_DANRE Fibronectin leucine-rich transmembrane protein 1b OS=Danio rerio OX=7955 GN=flrt1b PE=1 SV=2
11	PDB:1xcdA	0.276	0.551	1.262E-11	305	0.103	0.226	1xcdA.pdb.gz
12	PDB:7wv3A	0.348	0.350	1.392E-11	668	0.129	0.130	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:6gffI	0.269	0.319	1.309E-10	551	0.122	0.149	6gffI.pdb.gz
14	PDB:5yq5B	0.385	0.816	2.029E-10	306	0.129	0.284	5yq5B.pdb.gz
15	PDB:2ft3F	0.326	0.680	7.941E-10	305	0.107	0.236	2ft3F.pdb.gz
16	PDB:3t6qA	0.337	0.372	1.173E-9	601	0.105	0.118	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:7wrqA	0.180	0.204	1.216E-8	566	0.177	0.210	7wrqA.pdb.gz
18	PDB:7tvfD	0.357	0.451	1.340E-8	515	0.117	0.153	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
19	PDB:3b2dA	0.288	0.314	1.979E-8	601	0.107	0.120	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:5y31B	0.121	0.157	1.390E-7	511	0.085	0.112	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6EMK4	0.0	1326	673	1.000	1.000	VASN_HUMAN Vasorin OS=Homo sapiens OX=9606 GN=VASN PE=1 SV=1
2	Q9CZT5	0.0	985	673	0.820	0.820	VASN_MOUSE Vasorin OS=Mus musculus OX=10090 GN=Vasn PE=2 SV=2
3	A8DZ86	2.59e-142	433	688	0.388	0.379	A8DZ86_DANRE Vasorin a OS=Danio rerio OX=7955 GN=id:ibd2098 PE=1 SV=1
4	Q9HBW1	3.84e-35	143	653	0.160	0.165	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
5	Q45R42	4.72e-35	143	652	0.160	0.166	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
6	Q99PH1	5.42e-35	143	652	0.160	0.166	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
7	E9QDQ3	3.88e-34	141	858	0.166	0.131	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
8	Q9NT99	7.98e-33	137	713	0.165	0.156	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
9	Q8C031	9.70e-33	136	640	0.165	0.173	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
10	P0CC10	1.44e-32	136	709	0.163	0.155	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
11	P0C192	1.46e-32	136	709	0.163	0.155	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
12	Q9HCJ2	2.16e-32	135	640	0.163	0.172	LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1
13	Q8BLU0	2.11e-30	129	660	0.241	0.245	FLRT2_MOUSE Leucine-rich repeat transmembrane protein FLRT2 OS=Mus musculus OX=10090 GN=Flrt2 PE=1 SV=1
14	Q503I7	8.16e-30	127	647	0.178	0.185	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
15	Q24250	3.35e-28	122	733	0.166	0.153	Q24250_DROME Tartan protein OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
16	D2XV92	1.27e-27	122	1513	0.204	0.091	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1
17	Q8R5M3	1.30e-27	120	578	0.146	0.170	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
18	M9PFH7	2.00e-27	120	751	0.163	0.146	M9PFH7_DROME Tartan, isoform B OS=Drosophila melanogaster OX=7227 GN=trn PE=4 SV=1
19	Q9VU51	2.59e-27	120	737	0.163	0.149	Q9VU51_DROME GH10871p OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
20	P24014	3.43e-27	120	1504	0.183	0.082	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.16	23.6	EGF-like domain
2	PF07974 EGF_2	49	15.7	EGF-like domain
3	PF00041 fn3	0.18	23.5	Fibronectin type III domain
4	PF12661 hEGF	11	18.0	Human growth factor-like EGF
5	PF01462 LRRNT	0.28	22.1	Leucine rich repeat N-terminal domain
6	PF00560 LRR_1	20	17.0	Leucine Rich Repeat
7	PF12799 LRR_4	5.4e-14	63.3	Leucine Rich repeats (2 copies)
8	PF13306 LRR_5	0.012	27.0	BspA type Leucine rich repeat region (6 copies)
9	PF13855 LRR_8	2.7e-33	124.8	Leucine rich repeat
10	PF14580 LRR_9	0.18	22.8	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306864

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355402	0.857	Immunoglobulin superfamily containing leucine-rich repeat protein 2
2	9606.ENSP00000238682	0.717	Transforming growth factor beta-3
3	9606.ENSP00000355896	0.700	Transforming growth factor beta-2
4	9606.ENSP00000292672	0.671	CUGBP Elav-like family member 5
5	9606.ENSP00000221930	0.645	Transforming growth factor beta-1
6	9606.ENSP00000307701	0.552	Tetraspanin-5
7	9606.ENSP00000294785	0.518	Nicastrin
8	9606.ENSP00000251588	0.517	Cytosolic Fe-S cluster assembly factor NARFL
9	9606.ENSP00000357842	0.516	Tuftelin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.437	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.983	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0048583	0.802	regulation of response to stimulus
GO:0048519	0.799	negative regulation of biological process
GO:0048523	0.781	negative regulation of cellular process
GO:0010646	0.772	regulation of cell communication
GO:0023051	0.771	regulation of signaling
GO:0009966	0.752	regulation of signal transduction
GO:0010717	0.741	regulation of epithelial to mesenchymal transition
GO:0090092	0.691	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050896	0.690	response to stimulus
GO:0090287	0.547	regulation of cellular response to growth factor stimulus
GO:1903844	0.541	regulation of cellular response to transforming growth factor beta stimulus
GO:0051239	0.494	regulation of multicellular organismal process
GO:0051716	0.455	cellular response to stimulus
GO:0017015	0.419	regulation of transforming growth factor beta receptor signaling pathway
GO:0048518	0.399	positive regulation of biological process
GO:0048522	0.368	positive regulation of cellular process
GO:0071704	0.336	organic substance metabolic process
GO:0048585	0.329	negative regulation of response to stimulus
GO:0006950	0.314	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005576	0.996	extracellular region
GO:0031982	0.993	vesicle
GO:0005886	0.969	plasma membrane
GO:0070013	0.943	intracellular organelle lumen
GO:0012505	0.940	endomembrane system
GO:0043230	0.900	extracellular organelle
GO:0065010	0.881	extracellular membrane-bounded organelle
GO:1903561	0.867	extracellular vesicle
GO:0070062	0.852	extracellular exosome
GO:0031090	0.790	organelle membrane
GO:0005773	0.544	vacuole
GO:0031410	0.537	cytoplasmic vesicle
GO:0005774	0.453	vacuolar membrane
GO:0000323	0.429	lytic vacuole
GO:0009986	0.410	cell surface
GO:0098852	0.392	lytic vacuole membrane
GO:0005765	0.382	lysosomal membrane
GO:0032991	0.343	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]