StarFunc result for job id Q6F5E8

User Input

>input (1435 residues)
MAQTPDGISCELRGEITRFLWPKEVELLLKTWLPGEGAVQNHVLALLRWRAYLLHTTCLP
LRVDCTFSYLEVQAMALQETPPQVTFELESLRELVLEFPGVAALEQLAQHVAAAIKKVFP
RSTLGKLFRRPTPASMLARLERSSPSESTDPCSPCGGFLETYEALCDYNGFPFREEIQWD
VDTIYHRQGCRHFSLGDFSHLGSRDLALSVAALSYNLWFRCLSCVDMKLSLEVSEQILHM
MSQSSHLEELVLETCSLRGDFVRRLAQALAGHSSSGLRELSLAGNLLDDRGMTALSRHLE
RCPGALRRLSLAQTGLTPRGMRALGRALATNAAFDSTLTHLDLSGNPGALGASEDSGGLY
SFLSRPNVLSFLNLAGTDTALDTVRGCSVGGWMTGRADWRAGRGGLGPPAGVANSLPPQL
FAAVSRGCCTSLTHLDASRNVFSRTKSRAAPAALQLFLSRARTLRHLGLAGCKLPPDALR
ALLDGLALNTHLRDLHLDLSACELRSAGAQVIQDLVCDAGAVSSLDLADNGFGSDMVTLV
LAIGRSRSLRHVALGRNFNVRCKETLDDVLHRIVQLMQDDDCPLQSLSVAESRLKLGASV
LLRALATNPNLTALDISGNAMGDAGAKLLAKALRVNSRLRSVVWDRNHTSALGLLDVAQA
LEQNHSLKAMPLPLNDVAQAQRSRPELTARAVHQIQACLLRNNRADPASSDHTTRLQPLG
LVSDPSEQEVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAG
SSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQATLDTARSLCPQMLQGSSWREQLEGVL
AGSRGLPELLPEQLLQDAFTRLRDMRLSITGTLAESIVAQALAGLSAARDQLVESLAQQA
TVTMPPALPAPDGGEPSLLEPGELEGLFFPEEKEEEKEKDDSPPQKWPELSHGLHLVPFI
HSAAEEAEPEPELAAPGEDAEPQAGPSARGSPSPAAPGPPAGPLPRMDLPLAGQPLRHPT
RARPRPRRQHHHRPPPGGPQVPPALPQEGNGLSARVDEGVEEFFSKRLIQQDRLWAPEED
PATEGGATPVPRTLRKKLGTLFAFKKPRSTRGPRTDLETSPGAAPRTRKTTFGDLLRPPT
RPSRGEELGGAEGDTSSPDPAGRSRPRYTRDSKAYSMILLPAEEEATLGARPDKRRPLER
GETELAPSFEQRVQVMLQRIGVSRGSGGAEGKRKQSKDGEIKKAGSDGDIMDSSTEAPPI
SIKSRTHSVSADPSCRPGPGSQGPESATWKTLGQQLNAELRSRGWGQQDGPGPPSPGQSP
SPCRTSPSPDSLGLPEDPCLGPRNEDGQLRPRPLSAGRRAVSVHEDQLQAPAERPLRLQR
SPVLKRRPKLEAPPSPSLGSGLGTEPLPPQPTEPSSPERSPPSPATDQRGGGPNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6F5E8	1.000	1.000	0.000	1435	1.000	1.000	Q6F5E8.pdb.gz	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
2	AFDB:Q8ND23	0.454	0.474	9.389E-79	1372	0.353	0.370	Q8ND23.pdb.gz	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
3	AFDB:Q6EDY6	0.444	0.463	2.842E-73	1374	0.297	0.310	Q6EDY6.pdb.gz	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
4	AFDB:A0A0B4KEE7	0.433	0.419	4.290E-64	1486	0.256	0.248	A0A0B4KEE7.pdb.gz	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
5	PDB:1a4yA	0.218	0.580	1.484E-10	460	0.070	0.217	1a4yA.pdb.gz
6	PDB:6o60C	0.199	0.586	4.040E-7	389	0.049	0.180	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
7	PDB:7pzcA	0.182	0.245	1.543E-6	1010	0.072	0.102	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
8	PDB:3oglB	0.197	0.417	6.151E-6	568	0.042	0.106	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
9	PDB:6npyA	0.186	0.309	7.635E-6	798	0.059	0.107	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
10	PDB:7lfhA	0.136	0.196	1.662E-5	806	0.061	0.108	7lfhA.pdb.gz
11	PDB:7sa1B	0.170	0.333	2.561E-5	624	0.064	0.147	7sa1B.pdb.gz
12	PDB:4kxfP	0.192	0.294	3.319E-5	866	0.058	0.096	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
13	PDB:1k5dC	0.142	0.407	8.226E-5	344	0.043	0.177	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
14	AFDB:Q6PR54	0.084	0.061	1.252E-4	2419	0.140	0.083	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
15	PDB:2p1nB	0.195	0.413	1.382E-4	571	0.056	0.142	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
16	AFDB:Q96RT1	0.145	0.147	1.555E-4	1412	0.114	0.116	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
17	AFDB:Q80TH2	0.152	0.155	2.294E-4	1402	0.119	0.122	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
18	AFDB:Q96NW7	0.150	0.142	5.214E-4	1537	0.132	0.123	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
19	AFDB:Q9H3S7	0.052	0.046	7.693E-4	1636	0.106	0.093	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
20	AFDB:Q5UIP0	0.079	0.059	2.580E-3	2472	0.126	0.073	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V3V9	0.0	1443	1296	0.523	0.579	CARL2_MOUSE Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Mus musculus OX=10090 GN=Carmil2 PE=1 SV=2
2	Q5VZK9	0.0	632	1371	0.298	0.312	CARL1_HUMAN F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1
3	Q6EDY6	0.0	604	1374	0.273	0.285	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
4	Q6F5E8	0.0	2867	1435	1.000	1.000	CARL2_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2
5	Q8ND23	0.0	677	1372	0.297	0.310	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
6	E1JGZ7	4.45e-128	432	1296	0.196	0.217	E1JGZ7_DROME Leucine-rich repeat, isoform G OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=2
7	E1JGZ8	3.92e-127	432	1429	0.196	0.197	E1JGZ8_DROME Leucine-rich repeat, isoform C OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
8	A1Z734	9.23e-127	431	1452	0.196	0.194	A1Z734_DROME Leucine-rich repeat, isoform B OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=2
9	A0A0B4KEE7	1.13e-123	423	1486	0.198	0.191	A0A0B4KEE7_DROME Leucine-rich repeat, isoform F OS=Drosophila melanogaster OX=7227 GN=LRR PE=1 SV=1
10	Q95VZ3	4.19e-73	268	1050	0.140	0.191	CARML_DICDI Protein CARMIL OS=Dictyostelium discoideum OX=44689 GN=carmil PE=1 SV=1
11	Q21301	4.64e-67	249	1056	0.144	0.196	Q21301_CAEEL CARMIL pleckstrin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=crml-1 PE=1 SV=2
12	Q54G18	2.29e-33	142	1115	0.105	0.135	GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum OX=44689 GN=gacW PE=3 SV=1
13	Q54B43	7.65e-26	118	861	0.099	0.165	Q54B43_DICDI Leucine-rich repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293920 PE=4 SV=1
14	H3BLT9	2.25e-17	90.9	1112	0.098	0.127	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
15	C3VPR7	5.48e-17	89.7	1065	0.098	0.132	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
16	Q7RTR2	5.48e-17	89.7	1065	0.098	0.132	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
17	Q5DU56	2.82e-09	64.3	1064	0.070	0.094	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
18	D4A523	3.37e-08	60.8	1035	0.057	0.079	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
19	Q647I9	8.13e-08	59.7	1098	0.069	0.090	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
20	P59047	1.18e-07	59.3	1200	0.059	0.070	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16000 CARMIL_C	1.1e-67	240.4	CARMIL C-terminus
2	PF17888 Carm_PH	2.3e-10	52.1	Carmil pleckstrin homology domain
3	PF00560 LRR_1	13	17.6	Leucine Rich Repeat
4	PF12799 LRR_4	4.1e+02	12.9	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	7.6e-10	49.1	Leucine Rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334958

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358813	0.811	Dual specificity protein kinase TTK
2	9606.ENSP00000380150	0.777	Caspase recruitment domain-containing protein 11
3	9606.ENSP00000365318	0.764	NF-kappa-B inhibitor-like protein 1
4	9606.ENSP00000363482	0.725	WASH complex subunit 2C
5	9606.ENSP00000303939	0.724	Cytotoxic T-lymphocyte protein 4
6	9606.ENSP00000339186	0.719	GRB2-related adapter protein 2
7	9606.ENSP00000394888	0.676	Dedicator of cytokinesis protein 8
8	9606.ENSP00000358120	0.664	Pleckstrin homology domain-containing family O member 1
9	9606.ENSP00000356828	0.616	CapZ-interacting protein
10	9606.ENSP00000264995	0.599	Mitochondrial ribosomal protein L3
11	9606.ENSP00000241051	0.582	DEP domain containing 7
12	9606.ENSP00000282633	0.566	WASH complex subunit 2A
13	9606.ENSP00000472929	0.559	Proto-oncogene vav
14	9606.ENSP00000376345	0.552	Growth factor receptor-bound protein 2
15	9606.ENSP00000354947	0.523	F-actin-capping protein subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005543	1.000	phospholipid binding
GO:0005515	0.994	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0048522	0.967	positive regulation of cellular process
GO:0050896	0.962	response to stimulus
GO:0016043	0.877	cellular component organization
GO:0051130	0.869	positive regulation of cellular component organization
GO:0030833	0.815	regulation of actin filament polymerization
GO:0043244	0.783	regulation of protein-containing complex disassembly
GO:0048519	0.708	negative regulation of biological process
GO:1901879	0.704	regulation of protein depolymerization
GO:0048523	0.701	negative regulation of cellular process
GO:1902905	0.690	positive regulation of supramolecular fiber organization
GO:0044089	0.617	positive regulation of cellular component biogenesis
GO:0032502	0.589	developmental process
GO:0051495	0.585	positive regulation of cytoskeleton organization
GO:0048856	0.581	anatomical structure development
GO:0030834	0.524	regulation of actin filament depolymerization
GO:0032273	0.513	positive regulation of protein polymerization
GO:0048583	0.450	regulation of response to stimulus
GO:0051716	0.437	cellular response to stimulus
GO:0007154	0.395	cell communication
GO:0006950	0.378	response to stress
GO:0007165	0.355	signal transduction
GO:0030029	0.350	actin filament-based process
GO:0030838	0.327	positive regulation of actin filament polymerization
GO:0040012	0.316	regulation of locomotion
GO:1902745	0.310	positive regulation of lamellipodium organization
GO:0043243	0.307	positive regulation of protein-containing complex disassembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005856	1.000	cytoskeleton
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0032991	0.991	protein-containing complex
GO:0015629	0.987	actin cytoskeleton
GO:0031982	0.908	vesicle
GO:0005829	0.903	cytosol
GO:0031410	0.866	cytoplasmic vesicle
GO:0005768	0.697	endosome
GO:0031252	0.596	cell leading edge
GO:0120025	0.515	plasma membrane bounded cell projection
GO:0001726	0.354	ruffle
GO:0030027	0.352	lamellipodium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]