StarFunc result for job id Q6FHJ7

User Input

>input (346 residues)
MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
KKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z1N6	0.828	0.817	2.632E-60	351	0.934	0.920	Q9Z1N6.pdb.gz	SFRP4_MOUSE Secreted frizzled-related sequence protein 4 OS=Mus musculus OX=10090 GN=Sfrp4 PE=2 SV=1
2	AFDB:D9ZGF6	0.390	0.414	1.397E-36	325	0.462	0.492	D9ZGF6.pdb.gz	D9ZGF6_HUMAN Secreted frizzled-related protein 3 OS=Homo sapiens OX=9606 GN=FRZB PE=3 SV=1
3	AFDB:A0A0B5JQ70	0.384	0.420	8.939E-36	315	0.436	0.479	A0A0B5JQ70.pdb.gz
4	AFDB:Q32N13	0.397	0.427	1.064E-35	319	0.454	0.492	Q32N13.pdb.gz	Q32N13_XENLA Secreted frizzled-related protein 3 OS=Xenopus laevis OX=8355 GN=frzb.S PE=2 SV=1
5	AFDB:B1WBV2	0.330	0.385	4.978E-16	295	0.173	0.203	B1WBV2.pdb.gz	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
6	AFDB:Q7ZXM6	0.332	0.384	1.414E-15	298	0.162	0.188	Q7ZXM6.pdb.gz	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
7	AFDB:Q9IA96	0.333	0.392	1.588E-15	292	0.171	0.202	Q9IA96.pdb.gz	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
8	AFDB:Q8AWG4	0.324	0.354	2.525E-15	315	0.171	0.187	Q8AWG4.pdb.gz	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
9	AFDB:F1QJG6	0.320	0.356	5.366E-15	310	0.191	0.213	F1QJG6.pdb.gz
10	AFDB:Q9GUF5	0.333	0.366	1.357E-14	314	0.214	0.236	Q9GUF5.pdb.gz	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
11	PDB:1ueaB	0.220	0.389	7.081E-4	181	0.038	0.072	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	PDB:7nycA	0.229	0.056	2.688E-3	1542	0.046	0.010	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:1gxdC	0.225	0.373	7.633E-3	192	0.055	0.099	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
14	PDB:4ifdI	0.134	0.186	1.470E-1	230	0.032	0.048	4ifdI.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
15	PDB:2i0qA	0.138	0.112	1.557E-1	461	0.026	0.020	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
16	PDB:1b9mA	0.158	0.205	1.749E-1	258	0.020	0.027	1b9mA.pdb.gz
17	PDB:3aqqA	0.154	0.428	2.625E-1	99	0.035	0.121	3aqqA.pdb.gz
18	PDB:6d6qI	0.137	0.233	2.781E-1	183	0.026	0.049	6d6qI.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
19	PDB:4owwB	0.137	0.325	3.507E-1	107	0.020	0.065	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
20	PDB:1bbuA	0.155	0.116	4.687E-1	486	0.014	0.010	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6FHJ7	0.0	712	346	1.000	1.000	SFRP4_HUMAN Secreted frizzled-related protein 4 OS=Homo sapiens OX=9606 GN=SFRP4 PE=1 SV=2
2	Q9JLS4	0.0	662	348	0.925	0.920	SFRP4_RAT Secreted frizzled-related protein 4 OS=Rattus norvegicus OX=10116 GN=Sfrp4 PE=2 SV=2
3	Q9Z1N6	0.0	641	351	0.934	0.920	SFRP4_MOUSE Secreted frizzled-related sequence protein 4 OS=Mus musculus OX=10090 GN=Sfrp4 PE=2 SV=1
4	Q32N13	5.40e-104	310	319	0.454	0.492	Q32N13_XENLA Secreted frizzled-related protein 3 OS=Xenopus laevis OX=8355 GN=frzb.S PE=2 SV=1
5	P97401	5.67e-103	307	323	0.457	0.489	SFRP3_MOUSE Secreted frizzled-related protein 3 OS=Mus musculus OX=10090 GN=Frzb PE=1 SV=1
6	D9ZGF6	7.62e-103	307	325	0.442	0.471	D9ZGF6_HUMAN Secreted frizzled-related protein 3 OS=Homo sapiens OX=9606 GN=FRZB PE=3 SV=1
7	Q92765	7.62e-103	307	325	0.442	0.471	SFRP3_HUMAN Secreted frizzled-related protein 3 OS=Homo sapiens OX=9606 GN=FRZB PE=1 SV=2
8	Q9W6E0	6.04e-101	302	315	0.445	0.489	Q9W6E0_DANRE Secreted frizzled-related protein 3 OS=Danio rerio OX=7955 GN=fzb1 PE=2 SV=1
9	Q13467	6.27e-33	130	585	0.156	0.092	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
10	Q8CHL0	1.77e-32	129	585	0.153	0.091	FZD5_RAT Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1
11	Q9EQD0	1.91e-32	129	585	0.153	0.091	FZD5_MOUSE Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3
12	Q9VVX3	1.64e-30	124	694	0.153	0.076	FRIZ2_DROME Frizzled-2 OS=Drosophila melanogaster OX=7227 GN=fz2 PE=1 SV=1
13	Q9UP38	1.65e-29	121	647	0.153	0.082	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
14	Q8AVJ9	1.83e-29	120	548	0.159	0.100	FZD7B_XENLA Frizzled-7-B OS=Xenopus laevis OX=8355 GN=fzd7-b PE=1 SV=1
15	Q9PUK8	1.98e-29	120	549	0.159	0.100	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
16	O70421	2.31e-29	120	642	0.153	0.083	FZD1_MOUSE Frizzled-1 OS=Mus musculus OX=10090 GN=Fzd1 PE=1 SV=3
17	Q90ZT3	4.18e-29	119	559	0.156	0.097	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1
18	Q6NV44	4.30e-29	119	559	0.156	0.097	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
19	Q8K4C8	5.76e-29	119	592	0.182	0.106	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
20	Q9R216	5.76e-29	119	592	0.182	0.106	FZD9_MOUSE Frizzled-9 OS=Mus musculus OX=10090 GN=Fzd9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01392 Fz	2.2e-24	97.6	Fz domain
2	PF01759 NTR	1.5e-11	55.4	UNC-6/NTR/C345C module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003815025.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003808698.1	0.909	Ligand for members of the frizzled family of seven transmembrane receptors
2	9597.XP_008961913.1	0.896	Ligand for members of the frizzled family of seven transmembrane receptors
3	9597.XP_003826283.1	0.893	Ligand for members of the frizzled family of seven transmembrane receptors
4	9597.XP_008952856.1	0.876	Ligand for members of the frizzled family of seven transmembrane receptors
5	9597.XP_003825868.1	0.872	Ligand for members of the frizzled family of seven transmembrane receptors
6	9597.XP_003808686.1	0.847	Ligand for members of the frizzled family of seven transmembrane receptors
7	9597.XP_003825867.1	0.845	Ligand for members of the frizzled family of seven transmembrane receptors
8	9597.XP_008964808.1	0.845	Ligand for members of the frizzled family of seven transmembrane receptors
9	9597.XP_003812432.1	0.844	Ligand for members of the frizzled family of seven transmembrane receptors
10	9597.XP_003810739.1	0.835	Ligand for members of the frizzled family of seven transmembrane receptors
11	9597.XP_003814758.1	0.834	Ligand for members of the frizzled family of seven transmembrane receptors
12	9597.XP_008970222.1	0.834	Ligand for members of the frizzled family of seven transmembrane receptors
13	9597.XP_003804860.1	0.832	Ligand for members of the frizzled family of seven transmembrane receptors
14	9597.XP_008972051.1	0.832	Ligand for members of the frizzled family of seven transmembrane receptors
15	9597.XP_008966074.1	0.830	Ligand for members of the frizzled family of seven transmembrane receptors
16	9597.XP_008970292.1	0.830	Ligand for members of the frizzled family of seven transmembrane receptors
17	9597.XP_003825519.1	0.820	Ligand for members of the frizzled family of seven transmembrane receptors
18	9597.XP_008962208.1	0.814	Ligand for members of the frizzled family of seven transmembrane receptors
19	9597.XP_003807889.1	0.744	Asporin
20	9597.XP_003824845.1	0.692	Wnt inhibitory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	0.999	Wnt-protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048856	0.995	anatomical structure development
GO:0048519	0.995	negative regulation of biological process
GO:0048523	0.993	negative regulation of cellular process
GO:0032501	0.992	multicellular organismal process
GO:0009966	0.988	regulation of signal transduction
GO:0009987	0.984	cellular process
GO:0048585	0.981	negative regulation of response to stimulus
GO:0007275	0.964	multicellular organism development
GO:0030111	0.964	regulation of Wnt signaling pathway
GO:0030178	0.936	negative regulation of Wnt signaling pathway
GO:0048513	0.932	animal organ development
GO:0048731	0.922	system development
GO:0050896	0.918	response to stimulus
GO:0060828	0.901	regulation of canonical Wnt signaling pathway
GO:0048518	0.891	positive regulation of biological process
GO:0048522	0.876	positive regulation of cellular process
GO:0051716	0.871	cellular response to stimulus
GO:0042127	0.865	regulation of cell population proliferation
GO:0090090	0.860	negative regulation of canonical Wnt signaling pathway
GO:0009653	0.857	anatomical structure morphogenesis
GO:0007154	0.824	cell communication
GO:0023052	0.818	signaling
GO:0007165	0.813	signal transduction
GO:0001501	0.794	skeletal system development
GO:0008285	0.791	negative regulation of cell population proliferation
GO:0019222	0.788	regulation of metabolic process
GO:0060255	0.765	regulation of macromolecule metabolic process
GO:0051171	0.632	regulation of nitrogen compound metabolic process
GO:0080090	0.624	regulation of primary metabolic process
GO:0009887	0.586	animal organ morphogenesis
GO:1905114	0.558	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0198738	0.556	cell-cell signaling by wnt
GO:0031323	0.551	regulation of cellular metabolic process
GO:0016055	0.536	Wnt signaling pathway
GO:0048705	0.511	skeletal system morphogenesis
GO:0050793	0.507	regulation of developmental process
GO:0010468	0.503	regulation of gene expression
GO:0060348	0.503	bone development
GO:0023056	0.486	positive regulation of signaling
GO:0060349	0.460	bone morphogenesis
GO:0010556	0.426	regulation of macromolecule biosynthetic process
GO:0031326	0.408	regulation of cellular biosynthetic process
GO:0019219	0.408	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.402	regulation of DNA-templated transcription
GO:0030154	0.351	cell differentiation
GO:0009893	0.347	positive regulation of metabolic process
GO:0010604	0.333	positive regulation of macromolecule metabolic process
GO:0051239	0.331	regulation of multicellular organismal process
GO:0010647	0.330	positive regulation of cell communication
GO:0009888	0.322	tissue development
GO:0048584	0.315	positive regulation of response to stimulus
GO:0009967	0.312	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005737	0.998	cytoplasm
GO:0043227	0.972	membrane-bounded organelle
GO:0043229	0.961	intracellular organelle
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005634	0.783	nucleus
GO:0071944	0.341	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]