StarFunc result for job id Q6GMR7

User Input

>input (532 residues)
MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLLLSGMQLAKLI
RQRKVKCIDVVQAYINRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENK
WPFLGVPLTVKEAFQLQGMPNSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELC
MWYESSNKIYGRSNNPYDLQHIVGGSSGGEGCTLAAACSVIGVGSDIGGSIRMPAFFNGI
FGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLAPMLKVMAGPGIKRLKLDTKV
HLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKLKKMKYSFQLW
IAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRY
SNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGVFSAL
GLPVTQCPLGLNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GMR7	1.000	1.000	0.000	532	1.000	1.000	Q6GMR7.pdb.gz	FAAH2_HUMAN Fatty-acid amide hydrolase 2 OS=Homo sapiens OX=9606 GN=FAAH2 PE=1 SV=1
2	AFDB:Q7K2E1	0.913	0.918	9.154E-60	529	0.444	0.446	Q7K2E1.pdb.gz	Q7K2E1_DROME LD05247p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8839 PE=1 SV=1
3	AFDB:K9NBS6	0.742	0.823	5.020E-32	477	0.227	0.254	K9NBS6.pdb.gz	AAM_RHOER Acylamidase OS=Rhodococcus erythropolis OX=1833 GN=aam PE=1 SV=1
4	AFDB:O59805	0.718	0.717	2.350E-31	533	0.229	0.229	O59805.pdb.gz	YJV7_SCHPO Putative amidase C550.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.07 PE=3 SV=1
5	AFDB:Q17449	0.707	0.660	7.474E-30	572	0.218	0.203	Q17449.pdb.gz	FAAH1_CAEEL Fatty acid amide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=faah-1 PE=1 SV=1
6	AFDB:Q84DC4	0.727	0.761	9.753E-30	507	0.216	0.227	Q84DC4.pdb.gz	MANHY_PSEPU Mandelamide hydrolase OS=Pseudomonas putida OX=303 GN=mdlY PE=1 SV=1
7	AFDB:P08158	0.697	0.678	1.273E-29	548	0.231	0.224	P08158.pdb.gz	AMDS_EMENI Acetamidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=amdS PE=2 SV=1
8	AFDB:Q9CZN8	0.724	0.732	1.416E-29	525	0.231	0.234	Q9CZN8.pdb.gz	GATA_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Mus musculus OX=10090 GN=Qrsl1 PE=1 SV=1
9	AFDB:Q936X3	0.711	0.820	2.167E-29	457	0.216	0.252	Q936X3.pdb.gz	ATZE_PSESD 1-carboxybiuret hydrolase subunit AtzE OS=Pseudomonas sp. (strain ADP) OX=47660 GN=atzE PE=1 SV=1
10	AFDB:Q97SE6	0.713	0.773	3.146E-29	488	0.224	0.244	Q97SE6.pdb.gz	GATA_STRPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gatA PE=1 SV=1
11	PDB:3qj9A	0.689	0.669	4.197E-29	549	0.229	0.222	3qj9A.pdb.gz	Discovery and molecular basis of potent noncovalent inhibitors of fatty acid amide hydrolase (FAAH).
12	PDB:6c6gA	0.717	0.827	3.008E-28	457	0.214	0.249	6c6gA.pdb.gz	An unexpected vestigial protein complex reveals the evolutionary origins of ans-triazine catabolic enzyme.
13	PDB:6diiH	0.711	0.620	1.444E-25	616	0.186	0.161	6diiH.pdb.gz	Structural analysis of a plant fatty acid amide hydrolase provides insights into the evolutionary diversity of bioactive acylethanolamides.
14	PDB:4n0iA	0.613	0.715	8.464E-22	450	0.177	0.209	4n0iA.pdb.gz	Crystal structure of Saccharomyces cerevisiae mitochondrial GatFAB reveals a novel subunit assembly in tRNA-dependent amidotransferases
15	PDB:5yymA	0.101	0.097	4.849E-1	581	0.073	0.067	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
16	PDB:4ga6A	0.097	0.103	5.393E-1	493	0.077	0.083	4ga6A.pdb.gz	Structure analysis of archaeal AMP phosphorylase reveals two unique modes of dimerization
17	PDB:4tozA	0.080	0.081	7.829E-1	515	0.045	0.047	4tozA.pdb.gz
18	PDB:2oz5A	0.061	0.109	1.198	265	0.049	0.098	2oz5A.pdb.gz	Structural Basis for Selective Inhibition of Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB.
19	PDB:7rzwB	0.059	0.038	1.483	864	0.019	0.012	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
20	PDB:6jilB	0.054	0.086	1.835	298	0.026	0.047	6jilB.pdb.gz	Cyclization mechanism catalyzed by an ATP-grasp enzyme essential for d-cycloserine biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6GMR7	0.0	1093	532	1.000	1.000	FAAH2_HUMAN Fatty-acid amide hydrolase 2 OS=Homo sapiens OX=9606 GN=FAAH2 PE=1 SV=1
2	Q7K2E1	6.65e-152	447	529	0.430	0.433	Q7K2E1_DROME LD05247p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8839 PE=1 SV=1
3	Q17449	9.49e-34	137	572	0.241	0.224	FAAH1_CAEEL Fatty acid amide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=faah-1 PE=1 SV=1
4	O59805	1.62e-31	130	533	0.233	0.233	YJV7_SCHPO Putative amidase C550.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.07 PE=3 SV=1
5	K9NBS6	1.51e-30	126	477	0.246	0.275	AAM_RHOER Acylamidase OS=Rhodococcus erythropolis OX=1833 GN=aam PE=1 SV=1
6	Q90578	5.53e-27	115	464	0.156	0.179	VDHAP_CHICK Vitamin D3 hydroxylase-associated protein OS=Gallus gallus OX=9031 PE=1 SV=3
7	O06491	7.65e-27	115	485	0.244	0.268	GATA_BACSU Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=gatA PE=1 SV=3
8	P9WQ93	1.13e-24	109	475	0.248	0.278	AMI4_MYCTU Putative amidase AmiD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=amiD PE=1 SV=1
9	Q97SE6	7.21e-23	103	488	0.229	0.250	GATA_STRPN Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gatA PE=1 SV=1
10	Q936X3	2.48e-22	102	457	0.241	0.280	ATZE_PSESD 1-carboxybiuret hydrolase subunit AtzE OS=Pseudomonas sp. (strain ADP) OX=47660 GN=atzE PE=1 SV=1
11	Q9FR37	4.35e-21	97.8	425	0.199	0.249	AMI1_ARATH Amidase 1 OS=Arabidopsis thaliana OX=3702 GN=AMI1 PE=1 SV=1
12	Q9LI77	7.77e-21	98.2	537	0.229	0.227	GATA_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GATA PE=2 SV=1
13	Q84DC4	1.82e-20	96.7	507	0.227	0.239	MANHY_PSEPU Mandelamide hydrolase OS=Pseudomonas putida OX=303 GN=mdlY PE=1 SV=1
14	P08158	3.86e-20	95.9	548	0.237	0.230	AMDS_EMENI Acetamidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=amdS PE=2 SV=1
15	Q72DX1	1.46e-19	94.0	489	0.246	0.268	GATA_DESVH Glutamyl-tRNA(Gln) amidotransferase subunit A OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=gatA PE=1 SV=1
16	O08914	1.24e-18	91.7	579	0.133	0.123	FAAH1_MOUSE Fatty-acid amide hydrolase 1 OS=Mus musculus OX=10090 GN=Faah PE=1 SV=1
17	Q9VE09	5.10e-18	89.4	508	0.254	0.266	GATA_DROME Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Drosophila melanogaster OX=7227 GN=GatA PE=2 SV=1
18	O94509	4.08e-17	86.3	471	0.222	0.251	GATA_SCHPO Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC646.03 PE=3 SV=1
19	G5EAW7	1.41e-16	85.1	561	0.152	0.144	G5EAW7_EMENI amidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03957 PE=3 SV=1
20	Q8TFF9	2.30e-16	84.3	547	0.126	0.122	YP23_SCHPO Putative amidase PB8B6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB8B6.03 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01425 Amidase	3.7e-72	255.4	Amidase
2	PF18950 DUF5694	5.2e+02	12.3	Family of unknown function (DUF5694)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364035

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263985	0.837	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
2	9606.ENSP00000286733	0.804	N-acylethanolamine-hydrolyzing acid amidase
3	9606.ENSP00000414558	0.804	Protein ABHD4
4	9606.ENSP00000257215	0.801	Sn1-specific diacylglycerol lipase alpha
5	9606.ENSP00000407112	0.795	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
6	9606.ENSP00000297056	0.785	Sn1-specific diacylglycerol lipase beta
7	9606.ENSP00000244137	0.780	Xaa-Pro dipeptidase
8	9606.ENSP00000386928	0.775	Serine/threonine-protein kinase 16
9	9606.ENSP00000358513	0.774	Cannabinoid receptor 1
10	9606.ENSP00000384670	0.752	Acrosomal protein KIAA1210
11	9606.ENSP00000156109	0.747	RNA-binding protein involved in pre-mRNA splicing.
12	9606.ENSP00000265052	0.709	Monoglyceride lipase
13	9606.ENSP00000261386	0.705	Glycerophosphodiester phosphodiesterase 1
14	9606.ENSP00000379038	0.668	Thymidine phosphorylase
15	9606.ENSP00000355890	0.663	Bifunctional glutamate/proline--tRNA ligase
16	9606.ENSP00000276185	0.612	FERM and PDZ domain containing 3
17	9606.ENSP00000290765	0.608	Glutathione S-transferase theta-2B
18	9606.ENSP00000344241	0.601	Zinc finger matrin-type 5
19	9606.ENSP00000345001	0.598	CREB-regulated transcription coactivator 1
20	9606.ENSP00000375894	0.581	G-protein coupled receptor 55

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016811	1.000	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0005488	0.928	binding
GO:0005515	0.898	protein binding
GO:0017064	0.582	fatty acid amide hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0006631	0.969	fatty acid metabolic process
GO:0001676	0.937	long-chain fatty acid metabolic process
GO:0033559	0.934	unsaturated fatty acid metabolic process
GO:0120254	0.931	olefinic compound metabolic process
GO:0019369	0.924	arachidonic acid metabolic process
GO:0065007	0.338	biological regulation
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0016020	0.971	membrane
GO:0005737	0.938	cytoplasm
GO:0043227	0.931	membrane-bounded organelle
GO:0043231	0.902	intracellular membrane-bounded organelle
GO:0005811	0.813	lipid droplet
GO:0012505	0.465	endomembrane system
GO:0031090	0.351	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.5.1.-	1.000	In linear amides.
EC:3.5.1.99	0.582	fatty acid amide hydrolase.

[back to server]