StarFunc result for job id Q6GMV2

User Input

>input (418 residues)
MAASMCDVFSFCVGVAGRARVSVEVRFVSSAKGKGLFATQLIRKGETIFVERPLVAAQFL
WNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLPHPELCTVRKDLHQNCPHCQVMYCS
AECRLAATEQYHQVLCPGPSQDDPLHPLNKLQEAWRSIHYPPETASIMLMARMVATVKQA
KDKDRWIRLFSQFCNKTANEEEEIVHKLLGDKFKGQLELLRRLFTEALYEEAVSQWFTPD
GFRSLFALVGTNGQGIGTSSLSQWVHACDTLELKPQDREQLDAFIDQLYKDIEAATGEFL
NCEGSGLFVLQSCCNHSCVPNAETSFPENNFLLHVTALEDIKPGEEICISYLDCCQRERS
RHSRHKILRENYLFVCSCPKCLAEADEPNVTSEEEEEEEEEEEGEPEDAELGDEMTDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GMV2	1.000	1.000	2.690E-81	418	1.000	1.000	Q6GMV2.pdb.gz	SMYD5_HUMAN Histone-lysine N-trimethyltransferase SMYD5 OS=Homo sapiens OX=9606 GN=SMYD5 PE=1 SV=2
2	AFDB:F1RET2	0.920	0.926	7.941E-63	415	0.730	0.735	F1RET2.pdb.gz	SMYD5_DANRE Histone-lysine N-trimethyltransferase SMYD5 OS=Danio rerio OX=7955 GN=smyd5 PE=2 SV=3
3	AFDB:Q38AF8	0.645	0.596	4.256E-22	457	0.232	0.212	Q38AF8.pdb.gz	Q38AF8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2470 PE=4 SV=1
4	AFDB:Q5PP37	0.686	0.614	1.169E-19	473	0.199	0.175	Q5PP37.pdb.gz	ATXR2_ARATH Histone-lysine N-methyltransferase ATXR2 OS=Arabidopsis thaliana OX=3702 GN=ATXR2 PE=1 SV=1
5	AFDB:Q57XC0	0.578	0.603	3.737E-16	399	0.191	0.201	Q57XC0.pdb.gz	Q57XC0_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.760 PE=4 SV=1
6	AFDB:Q7XJS0	0.547	0.482	8.258E-14	480	0.182	0.158	Q7XJS0.pdb.gz	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
7	AFDB:Q582H7	0.482	0.470	1.085E-13	429	0.179	0.175	Q582H7.pdb.gz	Q582H7_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.380 PE=4 SV=1
8	AFDB:O94256	0.502	0.441	1.425E-13	483	0.165	0.143	O94256.pdb.gz	SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set6 PE=3 SV=1
9	PDB:5ex0A	0.491	0.481	1.566E-13	429	0.211	0.205	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
10	AFDB:E7EZZ6	0.470	0.460	2.894E-13	429	0.182	0.177	E7EZZ6.pdb.gz
11	AFDB:Q57YP8	0.495	0.390	2.894E-13	545	0.206	0.158	Q57YP8.pdb.gz	Q57YP8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.10 PE=4 SV=1
12	PDB:3n71A	0.455	0.412	3.549E-13	468	0.179	0.160	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
13	PDB:5v3hA	0.506	0.485	6.827E-13	438	0.177	0.169	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
14	PDB:3qxyA	0.390	0.388	1.034E-6	420	0.148	0.148	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
15	PDB:6ox1B	0.341	0.301	2.725E-5	484	0.115	0.099	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
16	PDB:2g46A	0.116	0.371	1.223E-2	119	0.036	0.126	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
17	PDB:5hynA	0.113	0.083	1.607E-2	581	0.026	0.019	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
18	PDB:7td5A	0.135	0.115	2.354E-2	497	0.041	0.034	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
19	PDB:5h6zA	0.114	0.355	2.625E-2	123	0.043	0.146	5h6zA.pdb.gz
20	PDB:5wg6A	0.105	0.086	3.264E-2	517	0.043	0.035	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RET2	0.0	633	415	0.734	0.740	SMYD5_DANRE Histone-lysine N-trimethyltransferase SMYD5 OS=Danio rerio OX=7955 GN=smyd5 PE=2 SV=3
2	Q3TYX3	0.0	748	416	0.892	0.897	SMYD5_MOUSE Histone-lysine N-trimethyltransferase SMYD5 OS=Mus musculus OX=10090 GN=Smyd5 PE=1 SV=2
3	Q6GMV2	0.0	868	418	1.000	1.000	SMYD5_HUMAN Histone-lysine N-trimethyltransferase SMYD5 OS=Homo sapiens OX=9606 GN=SMYD5 PE=1 SV=2
4	Q38AF8	4.02e-13	73.2	457	0.122	0.112	Q38AF8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2470 PE=4 SV=1
5	Q9NRG4	1.32e-11	68.2	433	0.208	0.201	SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2
6	Q8R5A0	9.31e-10	62.4	433	0.218	0.210	SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus OX=10090 GN=Smyd2 PE=1 SV=1
7	Q9CWR2	1.14e-09	62.4	428	0.220	0.215	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
8	Q9H7B4	1.17e-09	62.0	428	0.225	0.220	SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4
9	Q7M6Z3	2.37e-09	61.2	433	0.215	0.208	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
10	Q7XJS0	1.46e-08	58.9	480	0.084	0.073	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
11	Q5PP37	1.65e-08	58.5	473	0.203	0.180	ATXR2_ARATH Histone-lysine N-methyltransferase ATXR2 OS=Arabidopsis thaliana OX=3702 GN=ATXR2 PE=1 SV=1
12	B0G196	1.96e-08	58.5	594	0.203	0.143	B0G196_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0294629 PE=4 SV=1
13	Q57XC0	1.48e-07	55.5	399	0.067	0.070	Q57XC0_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.760 PE=4 SV=1
14	O74467	1.88e-07	54.7	319	0.072	0.094	SET5_SCHPO SET domain-containing protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set5 PE=1 SV=1
15	Q584A8	5.59e-07	54.3	673	0.139	0.086	Q584A8_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.220 PE=4 SV=1
16	Q582H7	1.88e-06	52.0	429	0.218	0.212	Q582H7_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.380 PE=4 SV=1
17	Q5RGL7	2.16e-06	52.0	434	0.091	0.088	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
18	Q8IYR2	9.74e-06	50.4	804	0.074	0.039	SMYD4_HUMAN SET and MYND domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SMYD4 PE=1 SV=3
19	Q8IDE8	1.41e-05	49.7	509	0.074	0.061	Q8IDE8_PLAF7 Histone-lysine N-methyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1355300 PE=4 SV=1
20	Q5BJI7	1.76e-05	49.3	435	0.067	0.064	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06761 IcmF-related	3.2e+02	12.2	Intracellular multiplication and human macrophage-killing
2	PF00856 SET	2.9e-09	49.0	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374152

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304360	0.839	SET and MYND domain containing 4
2	9606.ENSP00000393453	0.719	Histone-lysine N-methyltransferase SMYD1
3	9606.ENSP00000369666	0.679	F-box/LRR-repeat protein 19
4	9606.ENSP00000014914	0.673	Retinoic acid-induced protein 3
5	9606.ENSP00000357480	0.673	Dehydrodolichyl diphosphate synthase complex subunit NUS1
6	9606.ENSP00000385852	0.630	SET domain-containing protein 5
7	9606.ENSP00000327436	0.627	Histone-lysine N-methyltransferase setd3
8	9606.ENSP00000371846	0.600	Deformed epidermal autoregulatory factor 1 homolog
9	9606.ENSP00000228437	0.578	PR domain zinc finger protein 4
10	9606.ENSP00000268712	0.567	Nuclear receptor corepressor 1
11	9606.ENSP00000305899	0.564	Histone-lysine N-methyltransferase KMT5B
12	9606.ENSP00000380692	0.563	Lysine-specific demethylase 7A
13	9606.ENSP00000358217	0.550	PR domain zinc finger protein 13
14	9606.ENSP00000269844	0.546	PR domain zinc finger protein 15
15	9606.ENSP00000442924	0.539	Histone-lysine N-methyltransferase SETD1B
16	9606.ENSP00000384725	0.535	Putative histone-lysine N-methyltransferase PRDM6
17	9606.ENSP00000321320	0.527	Protein HGH1 homolog
18	9606.ENSP00000354689	0.520	Zinc transporter ZIP13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008276	0.969	protein methyltransferase activity
GO:0042054	0.958	histone methyltransferase activity
GO:0008757	0.716	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	0.684	N-methyltransferase activity
GO:0016278	0.669	lysine N-methyltransferase activity
GO:0016279	0.662	protein-lysine N-methyltransferase activity
GO:0018024	0.518	histone lysine N-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010528	0.995	regulation of transposition
GO:0048523	0.975	negative regulation of cellular process
GO:0045595	0.959	regulation of cell differentiation
GO:0009987	0.954	cellular process
GO:2000736	0.948	regulation of stem cell differentiation
GO:0010529	0.920	negative regulation of transposition
GO:0019222	0.530	regulation of metabolic process
GO:0060255	0.443	regulation of macromolecule metabolic process
GO:0010468	0.395	regulation of gene expression
GO:0071840	0.340	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.996	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0005829	0.451	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.973	Methyltransferases.
RHEA:51736	0.662	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]