StarFunc result for job id Q6GTX8

User Input

>input (287 residues)
MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRL
ERESRSTYNDTEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLV
KETSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLL
LVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSA
LAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GTX8	1.000	1.000	3.564E-47	287	1.000	1.000	Q6GTX8.pdb.gz	LAIR1_HUMAN Leukocyte-associated immunoglobulin-like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=2
2	AFDB:Q6ISS4	0.414	0.749	9.286E-24	152	0.411	0.776	Q6ISS4.pdb.gz	LAIR2_HUMAN Leukocyte-associated immunoglobulin-like receptor 2 OS=Homo sapiens OX=9606 GN=LAIR2 PE=1 SV=1
3	AFDB:Q8N423	0.319	0.160	8.050E-15	598	0.296	0.142	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
4	AFDB:Q8NHL6	0.324	0.148	1.267E-14	650	0.289	0.128	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
5	AFDB:Q8NHJ6	0.294	0.192	5.228E-14	448	0.317	0.203	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
6	AFDB:O75023	0.319	0.161	8.708E-14	590	0.247	0.120	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
7	AFDB:O75022	0.341	0.160	8.901E-13	631	0.251	0.114	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
8	AFDB:P97484	0.315	0.112	1.055E-12	841	0.226	0.077	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
9	AFDB:Q64281	0.325	0.280	6.852E-12	335	0.174	0.149	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
10	AFDB:P43630	0.310	0.199	9.629E-12	455	0.209	0.132	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
11	PDB:2q20B	0.246	0.560	4.864E-5	109	0.059	0.156	2q20B.pdb.gz
12	PDB:1f6lL	0.214	0.499	1.428E-4	106	0.056	0.151	1f6lL.pdb.gz
13	PDB:1wtlA	0.247	0.571	1.428E-4	108	0.052	0.139	1wtlA.pdb.gz
14	PDB:4m62L	0.252	0.562	1.693E-4	113	0.052	0.133	4m62L.pdb.gz
15	PDB:1d6vL	0.251	0.330	1.792E-4	211	0.063	0.085	1d6vL.pdb.gz	Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
16	PDB:1i7zA	0.258	0.328	2.124E-4	219	0.077	0.100	1i7zA.pdb.gz	Crystal structure of a cocaine-binding antibody.
17	PDB:1ct8A	0.250	0.324	2.248E-4	214	0.073	0.098	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
18	PDB:1uwxL	0.244	0.319	2.248E-4	211	0.063	0.085	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
19	PDB:1aifA	0.232	0.298	2.820E-4	215	0.056	0.074	1aifA.pdb.gz
20	PDB:6au5C	0.255	0.331	3.159E-4	213	0.066	0.089	6au5C.pdb.gz	Meditope-Fab interaction: threading the hole.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MZ84	0.0	536	269	0.906	0.967	A8MZ84_HUMAN Leukocyte associated immunoglobulin like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=2
2	D3YTC8	0.0	576	286	0.983	0.986	D3YTC8_HUMAN Leukocyte associated immunoglobulin like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=2
3	Q6GTX8	0.0	583	287	0.986	0.986	LAIR1_HUMAN Leukocyte-associated immunoglobulin-like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=2
4	Q6ISS4	8.86e-79	237	152	0.401	0.757	LAIR2_HUMAN Leukocyte-associated immunoglobulin-like receptor 2 OS=Homo sapiens OX=9606 GN=LAIR2 PE=1 SV=1
5	A6NI73	5.97e-19	86.7	299	0.174	0.167	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
6	Q8NHJ6	1.85e-18	87.0	448	0.171	0.109	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
7	O75022	6.84e-18	85.9	631	0.178	0.081	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
8	Q9HCN6	1.22e-16	80.9	339	0.185	0.156	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
9	Q28109	4.70e-16	78.2	264	0.160	0.174	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
10	P0C191	6.08e-16	78.6	313	0.153	0.141	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
11	O75019	6.59e-14	73.6	489	0.171	0.100	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
12	P59901	1.17e-13	72.8	499	0.153	0.088	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
13	Q8C567	1.40e-13	72.0	325	0.160	0.142	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
14	O75023	1.97e-13	72.4	590	0.143	0.069	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
15	O76036	2.07e-13	71.2	304	0.160	0.151	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
16	Q8N149	2.29e-13	72.0	483	0.160	0.095	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
17	Q8N423	2.21e-12	69.3	597	0.150	0.072	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
18	Q8NHL6	3.05e-12	68.9	650	0.171	0.075	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
19	Q8N6C8	3.69e-11	65.5	439	0.167	0.109	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
20	Q61450	2.57e-10	62.4	303	0.143	0.135	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16492 Cadherin_C_2	47	16.1	Cadherin cytoplasmic C-terminal
2	PF14851 FAM176	2.9e+02	12.6	FAM176 family
3	PF03597 FixS	5.8e+02	11.6	Cytochrome oxidase maturation protein cbb3-type
4	PF00047 ig	67	15.1	Immunoglobulin domain
5	PF13895 Ig_2	3.5e-05	35.3	Immunoglobulin domain
6	PF13927 Ig_3	0.065	25.1	Immunoglobulin domain
7	PF04277 OAD_gamma	1.8e+02	14.1	Oxaloacetate decarboxylase, gamma chain
8	PF14610 Psg1	5.2	18.4	Ykl077w/Psg1 (Pma1 Stabilization in Golgi)
9	PF15050 SCIMP	1.7e+02	14.1	SCIMP protein
10	PF15330 SIT	3.9e+02	12.9	SHP2-interacting transmembrane adaptor protein, SIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375622

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361366	0.959	Pulmonary surfactant-associated protein D
2	9606.ENSP00000391592	0.927	Tyrosine-protein phosphatase non-receptor type 6
3	9606.ENSP00000340944	0.861	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000220003	0.806	Tyrosine-protein kinase CSK
5	9606.ENSP00000198536	0.746	Paired immunoglobulin-like type 2 receptor alpha
6	9606.ENSP00000391748	0.739	Paired immunoglobin-like type 2 receptor beta
7	9606.ENSP00000410764	0.739	annotation not available
8	9606.ENSP00000302896	0.683	Ribosomal protein S9
9	9606.ENSP00000353259	0.635	CMRF35-like molecule 8
10	9606.ENSP00000254227	0.596	Nuclear receptor subfamily 0 group B member 2
11	9606.ENSP00000363773	0.585	Complement C1q subcomponent subunit A
12	9606.ENSP00000262629	0.554	TYRO protein tyrosine kinase-binding protein
13	9606.ENSP00000296585	0.554	Integrin alpha-2
14	9606.ENSP00000323328	0.541	Sialic acid-binding Ig-like lectin 7
15	9606.ENSP00000362524	0.540	Angiopoietin-related protein 2
16	9606.ENSP00000340937	0.536	Collagen alpha-1(XVII) chain
17	9606.ENSP00000271532	0.510	Fc receptor-like protein 4
18	9606.ENSP00000329507	0.504	CMRF35-like molecule 6
19	9606.ENSP00000355995	0.502	Corticosteroid 11-beta-dehydrogenase isozyme 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.647	signaling receptor activity
GO:0004888	0.383	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051239	0.991	regulation of multicellular organismal process
GO:0002682	0.991	regulation of immune system process
GO:0007165	0.987	signal transduction
GO:0048519	0.986	negative regulation of biological process
GO:0048583	0.985	regulation of response to stimulus
GO:0002694	0.975	regulation of leukocyte activation
GO:0002683	0.973	negative regulation of immune system process
GO:0007166	0.973	cell surface receptor signaling pathway
GO:0048518	0.969	positive regulation of biological process
GO:0051249	0.969	regulation of lymphocyte activation
GO:0050866	0.966	negative regulation of cell activation
GO:0050863	0.961	regulation of T cell activation
GO:0002695	0.960	negative regulation of leukocyte activation
GO:1903037	0.957	regulation of leukocyte cell-cell adhesion
GO:0050776	0.954	regulation of immune response
GO:0051250	0.954	negative regulation of lymphocyte activation
GO:0002703	0.945	regulation of leukocyte mediated immunity
GO:0070663	0.914	regulation of leukocyte proliferation
GO:0006950	0.902	response to stress
GO:0048522	0.897	positive regulation of cellular process
GO:0032944	0.866	regulation of mononuclear cell proliferation
GO:0050870	0.866	positive regulation of T cell activation
GO:0050670	0.863	regulation of lymphocyte proliferation
GO:0022408	0.855	negative regulation of cell-cell adhesion
GO:0002819	0.836	regulation of adaptive immune response
GO:0051171	0.827	regulation of nitrogen compound metabolic process
GO:0002706	0.824	regulation of lymphocyte mediated immunity
GO:0050868	0.801	negative regulation of T cell activation
GO:0002698	0.796	negative regulation of immune effector process
GO:0050777	0.793	negative regulation of immune response
GO:0010604	0.787	positive regulation of macromolecule metabolic process
GO:0031323	0.783	regulation of cellular metabolic process
GO:0046634	0.776	regulation of alpha-beta T cell activation
GO:0002704	0.761	negative regulation of leukocyte mediated immunity
GO:0050672	0.748	negative regulation of lymphocyte proliferation
GO:0002376	0.729	immune system process
GO:0032501	0.723	multicellular organismal process
GO:1902105	0.677	regulation of leukocyte differentiation
GO:0051049	0.675	regulation of transport
GO:0010721	0.582	negative regulation of cell development
GO:0080090	0.548	regulation of primary metabolic process
GO:0032502	0.513	developmental process
GO:0006952	0.495	defense response
GO:0002764	0.466	immune response-regulating signaling pathway
GO:0010468	0.462	regulation of gene expression
GO:0048584	0.438	positive regulation of response to stimulus
GO:0048856	0.416	anatomical structure development
GO:0002768	0.414	immune response-regulating cell surface receptor signaling pathway
GO:0001817	0.380	regulation of cytokine production
GO:0050778	0.373	positive regulation of immune response
GO:0031341	0.349	regulation of cell killing
GO:0031347	0.346	regulation of defense response
GO:0001775	0.342	cell activation
GO:0006955	0.338	immune response
GO:0045088	0.310	regulation of innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.700	endomembrane system
GO:0043227	0.616	membrane-bounded organelle
GO:0005622	0.589	intracellular anatomical structure
GO:0005737	0.557	cytoplasm
GO:0031982	0.523	vesicle
GO:0031410	0.487	cytoplasmic vesicle
GO:0031090	0.434	organelle membrane
GO:0070821	0.419	tertiary granule membrane
GO:0042581	0.380	specific granule
GO:0035579	0.363	specific granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]