StarFunc result for job id Q6GV28

User Input

>input (225 residues)
MVHVSNRSIQGMNILFSSWAVVLMVMGITLDKWVELISEDERAKMNHSPWMMCCPALWPE
DDLKVVRIMMTSSLGLSFLLNLILGMKFTYLIPQNKYIQLFTTILSFFSGISLLWALILY
HNKLKQGQSMHFSNYRITWIMYTAYLNVFFLSVCGVLSLLECKLSTSSCTCLNIHKSDNE
CKESENSIEDISLPECTAMPRSIVRAHTVNSLNKKVQTRHVTWAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D9S2	0.732	0.716	1.827E-18	230	0.440	0.430	Q9D9S2.pdb.gz	TM225_MOUSE Transmembrane protein 225 OS=Mus musculus OX=10090 GN=Tmem225 PE=1 SV=1
2	AFDB:P0DP42	0.656	0.667	3.087E-8	221	0.169	0.172	P0DP42.pdb.gz	T225B_HUMAN Transmembrane protein 225B OS=Homo sapiens OX=9606 GN=TMEM225B PE=1 SV=1
3	AFDB:P62955	0.560	0.463	1.606E-7	275	0.182	0.149	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
4	AFDB:Q8VHW8	0.594	0.498	1.974E-7	275	0.173	0.142	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
5	AFDB:Q6PFS3	0.604	0.434	4.990E-7	324	0.200	0.139	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
6	AFDB:P56857	0.614	0.531	7.934E-7	264	0.129	0.110	P56857.pdb.gz	CLD18_MOUSE Claudin-18 OS=Mus musculus OX=10090 GN=Cldn18 PE=1 SV=1
7	AFDB:O60359	0.577	0.426	1.550E-6	315	0.200	0.143	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
8	AFDB:O88602	0.549	0.396	1.550E-6	323	0.204	0.142	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
9	AFDB:P56856	0.615	0.539	1.810E-6	261	0.129	0.111	P56856.pdb.gz	CLD18_HUMAN Claudin-18 OS=Homo sapiens OX=9606 GN=CLDN18 PE=1 SV=1
10	AFDB:Q99PA5	0.610	0.811	1.905E-6	165	0.107	0.145	Q99PA5.pdb.gz	NKG7_MOUSE Protein NKG7 OS=Mus musculus OX=10090 GN=Nkg7 PE=2 SV=1
11	PDB:7rz4A	0.576	0.144	1.155E-5	993	0.116	0.026	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	PDB:7ocaI	0.601	0.718	3.075E-5	185	0.142	0.173	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:5weoA	0.551	0.137	4.045E-4	988	0.142	0.032	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
14	PDB:7rzaA	0.587	0.144	4.045E-4	981	0.098	0.022	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:6jp5E	0.538	0.697	7.507E-4	169	0.120	0.160	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
16	PDB:5b2gC	0.530	0.358	9.713E-4	350	0.107	0.069	5b2gC.pdb.gz
17	PDB:6ov2A	0.511	0.617	1.393E-3	182	0.129	0.159	6ov2A.pdb.gz
18	PDB:5kbtA	0.517	0.136	1.545E-3	973	0.138	0.032	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
19	PDB:6c14B	0.462	0.613	9.874E-3	164	0.067	0.091	6c14B.pdb.gz
20	PDB:7jpvE	0.438	0.670	5.136E-2	139	0.102	0.165	7jpvE.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D9S2	8.60e-70	215	230	0.467	0.457	TM225_MOUSE Transmembrane protein 225 OS=Mus musculus OX=10090 GN=Tmem225 PE=1 SV=1
2	P0DP42	0.014	37.7	221	0.191	0.195	T225B_HUMAN Transmembrane protein 225B OS=Homo sapiens OX=9606 GN=TMEM225B PE=1 SV=1
3	Q19096	1.6	32.0	371	0.173	0.105	Q19096_CAEEL SUppressor of activated let-60 Ras OS=Caenorhabditis elegans OX=6239 GN=sur-7 PE=1 SV=2
4	Q9FHI9	4.4	30.8	866	0.080	0.021	Q9FHI9_ARATH Transmembrane protein, putative (DUF594) OS=Arabidopsis thaliana OX=3702 GN=MFC19.14 PE=1 SV=1
5	O00555	9.0	30.0	2506	0.093	0.008	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
6	P27884	9.0	30.0	2424	0.093	0.009	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
7	P54282	9.0	30.0	2212	0.093	0.009	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
8	P97445	9.0	30.0	2368	0.093	0.009	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
9	Q9NS89	9.0	30.0	2472	0.093	0.008	Q9NS89_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha (Fragment) OS=Homo sapiens OX=9606 GN=CACNA1A PE=2 SV=1
10	Q8UN00	9.8	30.0	1738	0.053	0.007	Q8UN00_MLVMO Gag-Pol polyprotein OS=Moloney murine leukemia virus OX=11801 GN=gag-pro-pol PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	1.1e+02	14.0	PMP-22/EMP/MP20/Claudin tight junction
2	PF16080 Phage_holin_2_3	7e+02	11.5	Bacteriophage holin family HP1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364166

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411565	0.827	Dehydrogenase/reductase SDR family member 12
2	9606.ENSP00000334437	0.791	Nucleoside diphosphate-linked moiety X motif 17
3	9606.ENSP00000316775	0.778	Transmembrane protein 270
4	9606.ENSP00000362094	0.759	Gametocyte-specific factor 1-like
5	9606.ENSP00000257604	0.757	TRAF-type zinc finger domain-containing protein 1
6	9606.ENSP00000327234	0.754	Transmembrane and coiled-coil domains 5A
7	9606.ENSP00000326652	0.742	Protein FAM71F1
8	9606.ENSP00000331152	0.700	Max-interacting protein 1
9	9606.ENSP00000388895	0.681	Spermatogenesis-associated protein 3
10	9606.ENSP00000424400	0.681	Spermatogenesis-associated serine-rich protein 1
11	9606.ENSP00000347997	0.675	Ubiquilin-3
12	9606.ENSP00000265825	0.668	Fascin-3
13	9606.ENSP00000312774	0.656	Sperm acrosome membrane-associated protein 4
14	9606.ENSP00000453177	0.656	E3 ubiquitin-protein ligase TRIM69
15	9606.ENSP00000366237	0.641	DNA fragmentation factor subunit alpha
16	9606.ENSP00000370253	0.621	Homeobox protein Nkx-3.1
17	9606.ENSP00000380421	0.565	Interleukin 15 receptor subunit alpha
18	9606.ENSP00000281722	0.556	Probable RNA-binding protein 46
19	9606.ENSP00000351327	0.530	A-kinase anchor protein 4
20	9606.ENSP00000385158	0.526	Protein FAM161A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.625	enzyme regulator activity
GO:0004857	0.535	enzyme inhibitor activity
GO:0019208	0.466	phosphatase regulator activity
GO:0019899	0.457	enzyme binding
GO:0004864	0.429	protein phosphatase inhibitor activity
GO:0019902	0.383	phosphatase binding
GO:0019903	0.341	protein phosphatase binding
GO:0008157	0.304	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0050794	0.976	regulation of cellular process
GO:0019222	0.865	regulation of metabolic process
GO:0048519	0.841	negative regulation of biological process
GO:0048523	0.807	negative regulation of cellular process
GO:0031323	0.787	regulation of cellular metabolic process
GO:0065009	0.738	regulation of molecular function
GO:0009892	0.730	negative regulation of metabolic process
GO:0009987	0.646	cellular process
GO:0051336	0.611	regulation of hydrolase activity
GO:0031324	0.578	negative regulation of cellular metabolic process
GO:0051346	0.485	negative regulation of hydrolase activity
GO:0019220	0.400	regulation of phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0012505	0.998	endomembrane system
GO:0031410	0.990	cytoplasmic vesicle
GO:0031090	0.985	organelle membrane
GO:0098588	0.972	bounding membrane of organelle
GO:0030659	0.967	cytoplasmic vesicle membrane
GO:0030141	0.962	secretory granule
GO:0030667	0.926	secretory granule membrane
GO:0001669	0.898	acrosomal vesicle
GO:0002080	0.854	acrosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]