StarFunc result for job id Q6GYQ0

User Input

>input (2036 residues)
MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQHFSHIYYVFFE
NFVTIEASLKQKGHKSQREELDAILFIFEKILQLLPERIHQRWQFHSIGLILKKLLHTGN
SLKIRREGVRLFLLWLQALQNNCSKEQLWMFSCLIPGFSAPQSEHGPRTLDNLINPPLNL
QETQVTIEEITPLVPPQSGDKGQEDLTSYFLEALLKYIVIQVKSLEWKNKENQERGFSFL
FSHFKKYYLPYIFPNICKENSLYHPILDIPQMRPKPHYVVIKKDAETNEAIYCTKEPFIK
ARVIVIRWLVSFWLEPKPHTGPHIPGMEGEVLPKNIQRAAASLVSREESKNDNADKTDRT
TEPEQSHSNTSTLTEREPSSSSLCSIDEEHLTDIEIVRRVFSSKRSNVNFVTEIFRQAFL
LPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVITSSDLPCIENVTDHDISMEEGEK
REEENGTNTADHVRNSSWAKNGSYQGALHNASEEATEQNIRAGTQAVLQVFIINSSNIFL
LEPANEIKNLLDEHTDMCKRILNIYRYMVVQVSMDKKTWEQMLLVLLRVTESVLKMPSQA
FLQFQGKKNMTLAGRLAGPLFQTLIVAWIKANLNVYISRELWDDLLSVLSSLTYWEELAT
EWSLTMETLTKVLARNLYSLDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGW
SRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGN
EVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQKLPPLNSDIGGSSANVPDLMD
EFIAERLRSGNASTMTRRGSSPGSLEIPKDLPDILNKQNQMRPIDDPGVPSEWTSPASAG
SSDLISSDSHSDSFSAFQYDGRKFDNFGFGTDTGVTSSADVDSGSGHHQSAEEQEVASLT
TLHIDSETSSLNQQAFSAEVATITGSESASPVHSPLGSRSQTPSPSTLNIDHMEQKDLQL
DEKLHHSVLQTPDDLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNSIMD
PEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDK
YKQGKLHAYKLICNTMKRRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFF
SLGLPGATMLIMDFIVAAGRVASSAFLNAPRVEAQVLLGSLVCFPNLYCELPSLHPNIPD
VAVSQFTDVKELIIKTVLSSARDEPSGPARCVALCSLGIWICEELVHESHHPQIKEALNV
ICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASS
YEMDKRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYKVLHGCVYGA
QCFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQHG
LISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPELFESPNIQFF
VLNNTTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVS
GLSEPTSFMLSLSHQEKPEEPPTSNECLEDITVKDGLSLQFKRFRETVPTWDTIRDEEDV
LDELLQYLGVTSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKHF
NDLNMKAVEQDEPIPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNLD
SRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQK
NKSTGLTTPYFATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHTRDYRRG
IIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINAS
RALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFSPAPYHHLPSDADH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q8N1	0.781	0.740	0.000	2152	0.735	0.696	A0A2R8Q8N1.pdb.gz
2	AFDB:Q6GYQ0	1.000	1.000	0.000	2036	1.000	1.000	Q6GYQ0.pdb.gz	RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1
3	PDB:7dl2A	0.162	0.254	4.013E-15	1127	0.070	0.127	7dl2A.pdb.gz
4	PDB:7dl2B	0.164	0.286	4.730E-15	1042	0.072	0.141	7dl2B.pdb.gz
5	AFDB:O60292	0.110	0.124	9.771E-8	1781	0.081	0.093	O60292.pdb.gz	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
6	AFDB:O43166	0.110	0.122	2.415E-7	1804	0.081	0.091	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
7	AFDB:Q9P2F8	0.110	0.127	5.496E-7	1722	0.077	0.091	Q9P2F8.pdb.gz	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
8	AFDB:O35412	0.102	0.113	7.958E-7	1822	0.081	0.091	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
9	AFDB:Q9W1R4	0.057	0.074	3.647E-4	1395	0.103	0.151	Q9W1R4.pdb.gz	ICE1_DROME Little elongation complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Ice1 PE=1 SV=2
10	AFDB:Q9W517	0.092	0.102	3.801E-3	1741	0.063	0.074	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
11	PDB:4jlqA	0.074	0.142	4.199E-3	840	0.032	0.079	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
12	PDB:4a0cA	0.127	0.207	4.376E-3	1155	0.034	0.061	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
13	AFDB:Q68CQ1	0.064	0.089	7.044E-3	1323	0.045	0.069	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
14	PDB:3icqT	0.072	0.111	7.782E-3	949	0.042	0.090	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
15	PDB:6x9oA	0.118	0.102	8.449E-3	2425	0.029	0.024	6x9oA.pdb.gz
16	PDB:7mqaSP	0.103	0.088	8.449E-3	2485	0.079	0.065	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	AFDB:Q5T1Z8	0.065	0.087	8.652E-3	1224	0.045	0.074	Q5T1Z8.pdb.gz	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
18	PDB:6xu2A	0.097	0.158	9.173E-3	1091	0.030	0.056	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:2q5dB	0.097	0.189	1.038E-2	845	0.028	0.067	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
20	PDB:1b3uA	0.107	0.317	1.328E-2	588	0.021	0.071	1b3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KGS3	0.0	1160	1872	0.291	0.317	RGPA2_MOUSE Ral GTPase-activating protein subunit alpha-2 OS=Mus musculus OX=10090 GN=Ralgapa2 PE=1 SV=2
2	H7C1F9	0.0	1188	1740	0.289	0.339	H7C1F9_HUMAN Ral GTPase activating protein catalytic subunit alpha 2 (Fragment) OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=1
3	P86409	0.0	699	337	0.164	0.988	RGPA1_PIG Ral GTPase-activating protein subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=RALGAPA1 PE=1 SV=1
4	P86411	0.0	1162	1872	0.296	0.322	RGPA2_RAT Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Ralgapa2 PE=1 SV=1
5	Q2PPJ7	0.0	1189	1873	0.289	0.314	RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2 PE=1 SV=2
6	Q6GYP7	0.0	3951	2035	0.949	0.950	RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus OX=10090 GN=Ralgapa1 PE=1 SV=1
7	Q6GYQ0	0.0	4233	2036	1.000	1.000	RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1
8	V6CLC2	1.14e-38	161	1306	0.044	0.068	V6CLC2_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hgap-1 PE=1 SV=1
9	Q54VB2	1.42e-27	125	2935	0.038	0.026	Q54VB2_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280527 PE=4 SV=1
10	A0A0G2KHX4	1.42e-21	105	1674	0.035	0.042	A0A0G2KHX4_DANRE TSC complex subunit 2 OS=Danio rerio OX=7955 GN=fc16b02 PE=1 SV=1
11	A0A2R8YGU4	2.73e-21	104	1739	0.038	0.045	A0A2R8YGU4_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
12	A0A2R8YGD6	2.77e-21	104	1805	0.038	0.043	A0A2R8YGD6_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
13	A0A2R8Y7C8	3.00e-21	104	1782	0.038	0.044	A0A2R8Y7C8_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
14	A0A2R8Y5F1	3.10e-21	104	1738	0.038	0.045	A0A2R8Y5F1_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
15	P49816	8.15e-21	103	1809	0.038	0.043	TSC2_RAT Tuberin OS=Rattus norvegicus OX=10116 GN=Tsc2 PE=1 SV=1
16	A0A2R8YDZ2	2.79e-20	101	1760	0.036	0.042	A0A2R8YDZ2_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
17	H3BMQ0	3.10e-20	101	1751	0.037	0.043	H3BMQ0_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
18	X5D7Q2	3.15e-20	101	1740	0.037	0.043	X5D7Q2_HUMAN Tuberous sclerosis 2 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=2 SV=1
19	X5D2U8	3.20e-20	101	1741	0.037	0.043	X5D2U8_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
20	A0A2R8YDR3	3.40e-20	101	1781	0.037	0.042	A0A2R8YDR3_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20412 RALGAPB_N	6.7e-27	105.4	RALGAPB N-terminal domain
2	PF02145 Rap_GAP	4.4e-43	158.4	Rap/ran-GAP

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303580	0.812	NF-kappa-B inhibitor-interacting Ras-like protein 2
2	9606.ENSP00000421922	0.766	Alpha-2-macroglobulin receptor-associated protein
3	9606.ENSP00000401470	0.721	Ran GTPase-activating protein 1
4	9606.ENSP00000368589	0.681	Belongs to the Gfo/Idh/MocA family
5	9606.ENSP00000262879	0.610	Ral GTPase-activating protein subunit beta
6	9606.ENSP00000005257	0.596	Ras-related protein Ral-A
7	9606.ENSP00000449241	0.575	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
8	9606.ENSP00000374218	0.556	Extended synaptotagmin-3
9	9606.ENSP00000295878	0.554	Coiled-coil domain-containing protein 191
10	9606.ENSP00000377112	0.544	Solute carrier family 12 member 8
11	9606.ENSP00000359045	0.529	Rho GTPase-activating protein 4
12	9606.ENSP00000399718	0.528	MAP3K12-binding inhibitory protein 1
13	9606.ENSP00000260327	0.521	CTD small phosphatase-like protein 2
14	9606.ENSP00000263401	0.501	COMM domain-containing protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0046982	0.993	protein heterodimerization activity
GO:0098772	0.837	molecular function regulator activity
GO:0030234	0.809	enzyme regulator activity
GO:0030695	0.804	GTPase regulator activity
GO:0005096	0.706	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050794	0.937	regulation of cellular process
GO:0019222	0.873	regulation of metabolic process
GO:0060255	0.776	regulation of macromolecule metabolic process
GO:0080090	0.751	regulation of primary metabolic process
GO:0009987	0.718	cellular process
GO:0051171	0.682	regulation of nitrogen compound metabolic process
GO:0031323	0.678	regulation of cellular metabolic process
GO:0010468	0.406	regulation of gene expression
GO:0050896	0.344	response to stimulus
GO:0009889	0.319	regulation of biosynthetic process
GO:0010556	0.309	regulation of macromolecule biosynthetic process
GO:0031326	0.309	regulation of cellular biosynthetic process
GO:0019219	0.309	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.892	cytosol
GO:0016020	0.556	membrane
GO:0071944	0.412	cell periphery
GO:0070013	0.410	intracellular organelle lumen
GO:0005886	0.338	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]