StarFunc result for job id Q6H3X3

User Input

>input (334 residues)
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLT
LQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTM
SFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLL
ICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLP
IIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6H3X3	1.000	1.000	5.414E-60	334	1.000	1.000	Q6H3X3.pdb.gz	ULBP5_HUMAN UL-16 binding protein 5 OS=Homo sapiens OX=9606 GN=RAET1G PE=1 SV=1
2	AFDB:Q5VY80	0.555	0.744	1.640E-37	246	0.638	0.866	Q5VY80.pdb.gz	ULBP6_HUMAN UL16-binding protein 6 OS=Homo sapiens OX=9606 GN=RAET1L PE=1 SV=1
3	AFDB:Q9BZM6	0.578	0.774	1.186E-27	244	0.419	0.574	Q9BZM6.pdb.gz	ULBP1_HUMAN UL16-binding protein 1 OS=Homo sapiens OX=9606 GN=ULBP1 PE=1 SV=1
4	AFDB:Q9BZM4	0.537	0.725	1.280E-23	244	0.386	0.529	Q9BZM4.pdb.gz	ULBP3_HUMAN UL16-binding protein 3 OS=Homo sapiens OX=9606 GN=ULBP3 PE=1 SV=1
5	AFDB:Q8TD07	0.524	0.653	3.457E-19	263	0.249	0.316	Q8TD07.pdb.gz	RAE1E_HUMAN Retinoic acid early transcript 1E OS=Homo sapiens OX=9606 GN=RAET1E PE=1 SV=1
6	AFDB:Q8HWA3	0.515	0.515	7.496E-16	334	0.219	0.219	Q8HWA3.pdb.gz	Q8HWA3_MOUSE UL16 binding protein 1 OS=Mus musculus OX=10090 GN=Ulbp1 PE=1 SV=1
7	AFDB:O08602	0.451	0.579	2.775E-14	253	0.180	0.237	O08602.pdb.gz	RAE1A_MOUSE Retinoic acid early-inducible protein 1-alpha OS=Mus musculus OX=10090 GN=Raet1a PE=1 SV=1
8	AFDB:C5IXG6	0.523	0.447	2.939E-14	400	0.186	0.155	C5IXG6.pdb.gz	C5IXG6_RAT Rae-1-like protein OS=Rattus norvegicus OX=10116 GN=Raet1ll1 PE=2 SV=1
9	AFDB:Q6AYE9	0.476	0.492	2.939E-14	322	0.189	0.196	Q6AYE9.pdb.gz	Q6AYE9_RAT Retinoic acid early transcript 1L OS=Rattus norvegicus OX=10116 GN=Raet1l PE=2 SV=1
10	AFDB:Q9CZQ6	0.435	0.563	6.192E-14	251	0.198	0.263	Q9CZQ6.pdb.gz	RAE1E_MOUSE Retinoic acid early-inducible protein 1-epsilon OS=Mus musculus OX=10090 GN=Raet1e PE=1 SV=1
11	PDB:5j6hA	0.431	0.512	3.435E-10	275	0.117	0.142	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
12	PDB:6d7gA	0.390	0.344	1.145E-9	386	0.126	0.109	6d7gA.pdb.gz
13	PDB:6fgbA	0.431	0.531	1.145E-9	265	0.108	0.136	6fgbA.pdb.gz
14	PDB:3es6A	0.359	0.421	2.031E-9	277	0.120	0.144	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
15	PDB:2qriA	0.432	0.369	4.041E-9	398	0.129	0.108	2qriA.pdb.gz
16	PDB:6e1iA	0.388	0.340	8.040E-9	389	0.129	0.111	6e1iA.pdb.gz
17	PDB:6mp0A	0.433	0.378	1.272E-8	388	0.120	0.103	6mp0A.pdb.gz
18	PDB:3nwmA	0.400	0.353	1.347E-8	384	0.117	0.102	3nwmA.pdb.gz
19	PDB:4g59B	0.404	0.767	2.131E-8	163	0.096	0.196	4g59B.pdb.gz
20	PDB:3ov6A	0.396	0.356	1.248E-6	376	0.099	0.088	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6H3X3	0.0	689	334	1.000	1.000	ULBP5_HUMAN UL-16 binding protein 5 OS=Homo sapiens OX=9606 GN=RAET1G PE=1 SV=1
2	C9JAK3	1.00e-149	421	221	0.635	0.959	C9JAK3_HUMAN Retinoic acid early transcript 1G OS=Homo sapiens OX=9606 GN=RAET1G PE=1 SV=1
3	Q9BZM5	2.79e-143	406	246	0.611	0.829	ULBP2_HUMAN UL16-binding protein 2 OS=Homo sapiens OX=9606 GN=ULBP2 PE=1 SV=1
4	Q5VY80	1.92e-138	394	246	0.560	0.760	ULBP6_HUMAN UL16-binding protein 6 OS=Homo sapiens OX=9606 GN=RAET1L PE=1 SV=1
5	Q9BZM6	5.13e-96	286	244	0.440	0.602	ULBP1_HUMAN UL16-binding protein 1 OS=Homo sapiens OX=9606 GN=ULBP1 PE=1 SV=1
6	Q9BZM4	2.88e-82	251	244	0.398	0.545	ULBP3_HUMAN UL16-binding protein 3 OS=Homo sapiens OX=9606 GN=ULBP3 PE=1 SV=1
7	Q8TD07	8.58e-33	124	263	0.216	0.274	RAE1E_HUMAN Retinoic acid early transcript 1E OS=Homo sapiens OX=9606 GN=RAET1E PE=1 SV=1
8	Q9CZQ6	7.61e-15	75.5	251	0.171	0.227	RAE1E_MOUSE Retinoic acid early-inducible protein 1-epsilon OS=Mus musculus OX=10090 GN=Raet1e PE=1 SV=1
9	Q8HWE7	2.08e-12	69.7	395	0.135	0.114	MILL1_MOUSE MHC class I-like protein MILL1 OS=Mus musculus OX=10090 GN=Mill1 PE=1 SV=1
10	D2CKI9	1.83e-11	66.2	306	0.192	0.209	D2CKI9_MOUSE UL16 binding protein 1 OS=Mus musculus OX=10090 GN=Ulbp1 PE=1 SV=1
11	O08604	2.09e-11	65.5	253	0.144	0.190	RAE1C_MOUSE Retinoic acid early-inducible protein 1-gamma OS=Mus musculus OX=10090 GN=Raet1c PE=1 SV=1
12	Q8HWA3	4.53e-11	65.5	334	0.192	0.192	Q8HWA3_MOUSE UL16 binding protein 1 OS=Mus musculus OX=10090 GN=Ulbp1 PE=1 SV=1
13	O08603	2.95e-10	62.0	253	0.141	0.186	RAE1B_MOUSE Retinoic acid early-inducible protein 1-beta OS=Mus musculus OX=10090 GN=Raet1b PE=1 SV=1
14	O08602	3.40e-10	62.0	253	0.141	0.186	RAE1A_MOUSE Retinoic acid early-inducible protein 1-alpha OS=Mus musculus OX=10090 GN=Raet1a PE=1 SV=1
15	Q9D205	4.29e-10	62.4	334	0.186	0.186	Q9D205_MOUSE UL16-binding protein 1 OS=Mus musculus OX=10090 GN=Ulbp1 PE=2 SV=1
16	Q95460	5.18e-10	62.0	341	0.168	0.164	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
17	A0ZXM3	3.86e-09	59.7	357	0.129	0.120	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
18	Q8HWE5	1.12e-08	58.2	355	0.141	0.132	MILL2_MOUSE MHC class I-like protein MILL2 OS=Mus musculus OX=10090 GN=Mill2 PE=1 SV=1
19	Q6B0J5	2.51e-08	57.0	345	0.123	0.119	Q6B0J5_HUMAN HFE protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
20	Q30201	2.61e-08	57.0	348	0.117	0.112	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00129 MHC_I	1.9e-12	58.7	Class I Histocompatibility antigen, domains alpha 1 and 2
2	PF14586 MHC_I_2	7.2e-05	34.2	Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356329

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240618	0.996	Killer cell lectin-like receptor subfamily K, member 1
2	9606.ENSP00000349709	0.838	Retinoic acid early transcript 1E
3	9606.ENSP00000356310	0.812	UL16-binding protein 6
4	9606.ENSP00000480609	0.811	annotation not available
5	9606.ENSP00000252229	0.739	MHC class I polypeptide-related sequence B
6	9606.ENSP00000413079	0.730	MHC class I polypeptide-related sequence A
7	9606.ENSP00000246551	0.526	Hematopoietic cell signal transducer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046703	1.000	natural killer cell lectin-like receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0032101	0.995	regulation of response to external stimulus
GO:0002831	0.995	regulation of response to biotic stimulus
GO:0050776	0.995	regulation of immune response
GO:0031347	0.995	regulation of defense response
GO:0050778	0.994	positive regulation of immune response
GO:0002705	0.988	positive regulation of leukocyte mediated immunity
GO:0045087	0.987	innate immune response
GO:0002715	0.986	regulation of natural killer cell mediated immunity
GO:0001906	0.985	cell killing
GO:0002443	0.985	leukocyte mediated immunity
GO:0001909	0.984	leukocyte mediated cytotoxicity
GO:0002449	0.982	lymphocyte mediated immunity
GO:0002717	0.977	positive regulation of natural killer cell mediated immunity
GO:0051240	0.954	positive regulation of multicellular organismal process
GO:0050794	0.894	regulation of cellular process
GO:0048522	0.831	positive regulation of cellular process
GO:0001910	0.786	regulation of leukocyte mediated cytotoxicity
GO:0042269	0.761	regulation of natural killer cell mediated cytotoxicity
GO:0001817	0.641	regulation of cytokine production
GO:0009893	0.619	positive regulation of metabolic process
GO:0010604	0.595	positive regulation of macromolecule metabolic process
GO:0001912	0.581	positive regulation of leukocyte mediated cytotoxicity
GO:0002700	0.560	regulation of production of molecular mediator of immune response
GO:0010628	0.527	positive regulation of gene expression
GO:0045954	0.516	positive regulation of natural killer cell mediated cytotoxicity
GO:0001819	0.466	positive regulation of cytokine production
GO:0032501	0.426	multicellular organismal process
GO:0002228	0.391	natural killer cell mediated immunity
GO:0042267	0.354	natural killer cell mediated cytotoxicity
GO:0002718	0.350	regulation of cytokine production involved in immune response
GO:0045321	0.343	leukocyte activation
GO:0046649	0.334	lymphocyte activation
GO:0051716	0.325	cellular response to stimulus
GO:0002702	0.317	positive regulation of production of molecular mediator of immune response
GO:0048519	0.308	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005576	0.991	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]