StarFunc result for job id Q6H8Q1

User Input

>input (611 residues)
MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEG
GFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGD
RVTFNGKECMCQKCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKC
KSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVR
CGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRVIY
AKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYKQC
RTSSPSSTGSVSLGRYTPTSRSPQHYSRPGSESGRSTPSLSVLSDSKPPPSTYQQAPRHF
HVPDTGVKDNIYRKPPIYRQHAARRSDGEDGSLDQDNRKKSSWLMLKGDADTRTNSPDLD
TQSLSHSSGTDRDPLQRMAGDSFHSRFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDAS
WGMREYKIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWK
RNDLKKKALLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BL65	0.416	0.415	2.363E-96	612	0.912	0.910	Q8BL65.pdb.gz	ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus OX=10090 GN=Ablim2 PE=1 SV=1
2	AFDB:O94929	0.342	0.310	1.555E-62	683	0.548	0.490	O94929.pdb.gz	ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens OX=9606 GN=ABLIM3 PE=1 SV=3
3	AFDB:F1LWK7	0.382	0.389	2.418E-42	600	0.421	0.428	F1LWK7.pdb.gz	F1LWK7_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=4
4	PDB:4kfzB	0.110	0.404	6.945E-10	148	0.065	0.270	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
5	AFDB:P39083	0.148	0.098	2.151E-8	1007	0.134	0.081	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
6	PDB:1b8tA	0.105	0.307	3.697E-8	192	0.074	0.234	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
7	AFDB:Q06407	0.152	0.099	5.903E-7	1009	0.126	0.076	Q06407.pdb.gz	RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA2 PE=1 SV=1
8	AFDB:Q9UGP4	0.129	0.118	5.017E-4	676	0.087	0.078	Q9UGP4.pdb.gz	LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1
9	AFDB:A1ZA47	0.143	0.046	1.315E-3	2194	0.116	0.032	A1ZA47.pdb.gz	ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster OX=7227 GN=Zasp52 PE=1 SV=2
10	PDB:1imlA	0.093	0.584	2.708E-3	76	0.039	0.316	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
11	AFDB:E1BBG2	0.112	0.087	3.661E-3	853	0.136	0.097	E1BBG2.pdb.gz	MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus OX=9913 GN=MICALL1 PE=1 SV=2
12	AFDB:P49791	0.060	0.037	2.797E-1	1468	0.142	0.059	P49791.pdb.gz	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
13	PDB:7n9qA	0.068	0.029	3.350E-1	2315	0.041	0.011	7n9qA.pdb.gz
14	PDB:5dkaA	0.051	0.255	3.779E-1	96	0.028	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7dvq9	0.059	0.079	3.779E-1	409	0.023	0.034	7dvq9.pdb.gz	Structure of the activated human minor spliceosome.
16	AFDB:O59784	0.062	0.053	4.015E-1	761	0.151	0.121	O59784.pdb.gz	MDE7_SCHPO RNA-binding protein mde7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mde7 PE=4 SV=1
17	PDB:3b4vD	0.073	0.135	4.528E-1	213	0.036	0.103	3b4vD.pdb.gz
18	PDB:7uhyD	0.068	0.127	5.107E-1	288	0.023	0.049	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7uhyC	0.080	0.084	5.761E-1	578	0.018	0.019	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:4fjcE	0.057	0.076	6.119E-1	434	0.020	0.028	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y6A1	0.0	613	863	0.586	0.415	A0A8I5Y6A1_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
2	A0A8I5Y740	0.0	646	683	0.579	0.518	A0A8I5Y740_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
3	A0A8I5ZVV8	0.0	654	779	0.586	0.460	A0A8I5ZVV8_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
4	A0A8I6A592	0.0	551	745	0.453	0.372	A0A8I6A592_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
5	A0A8I6ABC6	0.0	652	702	0.584	0.509	A0A8I6ABC6_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
6	O14639	0.0	656	778	0.578	0.454	ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3
7	O94929	0.0	609	683	0.548	0.490	ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens OX=9606 GN=ABLIM3 PE=1 SV=3
8	Q69ZX8	0.0	603	682	0.550	0.493	ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus OX=10090 GN=Ablim3 PE=1 SV=2
9	Q6H8Q1	0.0	1265	611	1.000	1.000	ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2
10	Q8BL65	0.0	1119	612	0.912	0.910	ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus OX=10090 GN=Ablim2 PE=1 SV=1
11	Q8K4G5	0.0	613	861	0.583	0.413	ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus OX=10090 GN=Ablim1 PE=1 SV=1
12	F1LWK7	1.30e-178	521	603	0.421	0.426	F1LWK7_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=4
13	A0A8I6G9J9	2.66e-178	522	666	0.426	0.390	A0A8I6G9J9_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
14	A0A8I6GGU3	5.18e-177	519	669	0.422	0.386	A0A8I6GGU3_RAT Actin-binding LIM protein 1 OS=Rattus norvegicus OX=10116 GN=Ablim1 PE=1 SV=1
15	A0A126GUR5	7.42e-85	283	756	0.219	0.177	A0A126GUR5_DROME Uncoordinated 115b, isoform F OS=Drosophila melanogaster OX=7227 GN=Unc-115b PE=4 SV=1
16	Q8INN5	7.61e-85	282	749	0.219	0.179	Q8INN5_DROME Uncoordinated 115b, isoform B OS=Drosophila melanogaster OX=7227 GN=Unc-115b PE=4 SV=2
17	Q9VH92	8.66e-85	283	768	0.219	0.174	Q9VH92_DROME DUNC-115m OS=Drosophila melanogaster OX=7227 GN=Unc-115b PE=2 SV=2
18	Q8INN7	1.17e-84	282	760	0.214	0.172	Q8INN7_DROME Uncoordinated 115b, isoform D OS=Drosophila melanogaster OX=7227 GN=Unc-115b PE=4 SV=2
19	Q8INN6	1.35e-84	282	784	0.214	0.167	Q8INN6_DROME Uncoordinated 115b, isoform C OS=Drosophila melanogaster OX=7227 GN=Unc-115b PE=4 SV=1
20	A0A0B4LGY0	1.59e-84	282	772	0.214	0.170	A0A0B4LGY0_DROME Uncoordinated 115a, isoform H OS=Drosophila melanogaster OX=7227 GN=Unc-115a PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16182 AbLIM_anchor	6.7e-104	360.4	Putative adherens-junction anchoring region of AbLIM
2	PF17981 ADD_ATRX	8.2e+02	11.3	Cysteine Rich ADD domain
3	PF00412 LIM	5.3e-39	143.6	LIM domain
4	PF02209 VHP	1.7e-13	61.6	Villin headpiece domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.751	Netrin-1
2	9606.ENSP00000389140	0.742	Netrin receptor DCC
3	9606.ENSP00000265354	0.720	Serum response factor
4	9606.ENSP00000339299	0.710	Triple functional domain protein
5	9606.ENSP00000348461	0.661	Ras-related C3 botulinum toxin substrate 1
6	9606.ENSP00000340083	0.637	Lysine rich coiled-coil 1
7	9606.ENSP00000245105	0.631	SH3 domain and tetratricopeptide repeats 1
8	9606.ENSP00000373964	0.612	Smoothelin-like protein 2
9	9606.ENSP00000347719	0.611	Tubulin-specific chaperone D
10	9606.ENSP00000268679	0.610	Protein CBFA2T3
11	9606.ENSP00000280333	0.602	Dedicator of cytokinesis protein 1
12	9606.ENSP00000346671	0.602	Tyrosine-protein kinase Fyn
13	9606.ENSP00000341189	0.600	Focal adhesion kinase 1
14	9606.ENSP00000362680	0.600	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000417273	0.600	Cytoplasmic protein NCK1
16	9606.ENSP00000311816	0.540	RE1-silencing transcription factor
17	9606.ENSP00000354255	0.538	Carboxypeptidase Z
18	9606.ENSP00000385899	0.509	Protein sidekick-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.360	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0071704	0.875	organic substance metabolic process
GO:0044237	0.873	cellular metabolic process
GO:0044238	0.866	primary metabolic process
GO:0006807	0.820	nitrogen compound metabolic process
GO:0051173	0.789	positive regulation of nitrogen compound metabolic process
GO:0010604	0.788	positive regulation of macromolecule metabolic process
GO:0031325	0.779	positive regulation of cellular metabolic process
GO:0043170	0.723	macromolecule metabolic process
GO:0080090	0.713	regulation of primary metabolic process
GO:0009889	0.646	regulation of biosynthetic process
GO:0031326	0.641	regulation of cellular biosynthetic process
GO:0010556	0.639	regulation of macromolecule biosynthetic process
GO:0034654	0.617	nucleobase-containing compound biosynthetic process
GO:0010557	0.611	positive regulation of macromolecule biosynthetic process
GO:0031328	0.605	positive regulation of cellular biosynthetic process
GO:0045935	0.605	positive regulation of nucleobase-containing compound metabolic process
GO:0006351	0.603	DNA-templated transcription
GO:0045893	0.597	positive regulation of DNA-templated transcription
GO:0071840	0.555	cellular component organization or biogenesis
GO:0006366	0.518	transcription by RNA polymerase II
GO:0016043	0.514	cellular component organization
GO:0045944	0.458	positive regulation of transcription by RNA polymerase II
GO:0032501	0.421	multicellular organismal process
GO:0048856	0.408	anatomical structure development
GO:0050896	0.356	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005737	0.980	cytoplasm
GO:0005856	0.885	cytoskeleton
GO:0015629	0.788	actin cytoskeleton
GO:0043231	0.742	intracellular membrane-bounded organelle
GO:0099080	0.525	supramolecular complex
GO:0005829	0.473	cytosol
GO:0099512	0.472	supramolecular fiber
GO:0016020	0.401	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]