StarFunc result for job id Q6IA17

User Input

>input (410 residues)
MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGG
HYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVA
AVLASLLVLLALLLAALLYVKCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKF
VNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSH
SFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVTLLLWRPGSVTPSSDFW
KEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGVRG
PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IA17	1.000	1.000	8.111E-85	410	1.000	1.000	Q6IA17.pdb.gz	SIGIR_HUMAN Single Ig IL-1-related receptor OS=Homo sapiens OX=9606 GN=SIGIRR PE=1 SV=3
2	AFDB:Q9JLZ8	0.760	0.762	5.637E-71	409	0.810	0.812	Q9JLZ8.pdb.gz	SIGIR_MOUSE Single Ig IL-1-related receptor OS=Mus musculus OX=10090 GN=Sigirr PE=1 SV=2
3	AFDB:A1L1Q8	0.680	0.617	1.083E-45	458	0.463	0.415	A1L1Q8.pdb.gz
4	AFDB:Q9NP60	0.518	0.336	3.839E-26	686	0.239	0.143	Q9NP60.pdb.gz	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
5	AFDB:B6ZK77	0.431	0.268	1.394E-25	700	0.249	0.146	B6ZK77.pdb.gz	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
6	AFDB:B6ZK78	0.398	0.257	6.473E-25	681	0.254	0.153	B6ZK78.pdb.gz	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
7	AFDB:P59824	0.419	0.264	1.438E-24	696	0.246	0.145	P59824.pdb.gz	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
8	AFDB:Q61730	0.444	0.331	6.284E-22	570	0.180	0.130	Q61730.pdb.gz	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
9	AFDB:Q70YG5	0.425	0.320	2.917E-21	568	0.200	0.144	Q70YG5.pdb.gz	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
10	AFDB:Q9NPH3	0.422	0.318	3.102E-21	570	0.183	0.132	Q9NPH3.pdb.gz	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
11	PDB:4edqA	0.187	0.162	5.011E-6	483	0.056	0.048	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
12	PDB:3j0aA	0.264	0.146	6.025E-6	797	0.090	0.046	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
13	PDB:3o3uN	0.199	0.144	7.472E-5	580	0.046	0.033	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
14	PDB:5ir3A	0.167	0.543	1.660E-4	111	0.044	0.162	5ir3A.pdb.gz
15	PDB:1cd0A	0.167	0.530	2.714E-4	111	0.044	0.162	1cd0A.pdb.gz
16	PDB:2cd0A	0.177	0.573	4.171E-4	111	0.049	0.180	2cd0A.pdb.gz
17	PDB:7anwA	0.218	0.149	4.171E-4	645	0.056	0.036	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
18	PDB:3oaiA	0.161	0.139	5.332E-4	488	0.056	0.047	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
19	PDB:8e4cC	0.160	0.403	6.411E-4	142	0.068	0.197	8e4cC.pdb.gz
20	PDB:6enyC	0.184	0.205	8.196E-4	364	0.029	0.033	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IA17	0.0	828	410	1.000	1.000	SIGIR_HUMAN Single Ig IL-1-related receptor OS=Homo sapiens OX=9606 GN=SIGIRR PE=1 SV=3
2	Q9JLZ8	0.0	648	409	0.815	0.817	SIGIR_MOUSE Single Ig IL-1-related receptor OS=Mus musculus OX=10090 GN=Sigirr PE=1 SV=2
3	K9K3G6	1.10e-110	333	426	0.471	0.453	K9K3G6_DANRE SIGIRR protein OS=Danio rerio OX=7955 GN=sigirr PE=1 SV=1
4	A4JYJ7	1.84e-110	332	426	0.471	0.453	A4JYJ7_DANRE SIGIRR protein OS=Danio rerio OX=7955 GN=sc:d148 PE=2 SV=1
5	B6ZK78	6.63e-25	109	681	0.237	0.142	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
6	B6ZK77	5.38e-24	106	700	0.217	0.127	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
7	Q9NP60	7.21e-20	94.4	686	0.224	0.134	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
8	P59824	3.22e-18	89.0	696	0.207	0.122	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1
9	Q9NZN1	6.95e-18	88.2	696	0.207	0.122	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
10	P59823	5.03e-17	85.5	695	0.212	0.125	IRPL1_MOUSE Interleukin-1 receptor accessory protein-like 1 OS=Mus musculus OX=10090 GN=Il1rapl1 PE=1 SV=1
11	Q61098	1.58e-16	83.6	537	0.232	0.177	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
12	Q9NPH3	6.21e-16	82.0	570	0.139	0.100	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
13	Q13478	1.74e-15	80.5	541	0.220	0.166	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
14	Q61730	2.70e-15	80.1	570	0.139	0.100	IL1AP_MOUSE Interleukin-1 receptor accessory protein OS=Mus musculus OX=10090 GN=Il1rap PE=1 SV=1
15	Q63621	5.74e-15	79.0	570	0.137	0.098	IL1AP_RAT Interleukin-1 receptor accessory protein OS=Rattus norvegicus OX=10116 GN=Il1rap PE=2 SV=1
16	Q70YG5	3.27e-14	76.6	568	0.220	0.158	Q70YG5_SALSA Interleukin 1 receptor accessory protein OS=Salmo salar OX=8030 GN=il-1racp PE=2 SV=1
17	P14778	4.08e-13	73.2	569	0.183	0.132	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
18	Q01638	1.35e-12	71.6	556	0.198	0.146	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
19	Q9ERS7	3.69e-12	70.1	574	0.205	0.146	ILRL2_MOUSE Interleukin-1 receptor-like 2 OS=Mus musculus OX=10090 GN=Il1rl2 PE=1 SV=1
20	P14719	4.40e-11	67.0	567	0.188	0.136	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	5.2e+02	12.1	Immunoglobulin I-set domain
2	PF13895 Ig_2	0.12	24.0	Immunoglobulin domain
3	PF13927 Ig_3	1.2	21.1	Immunoglobulin domain
4	PF01582 TIR	7.4e-14	63.4	TIR domain
5	PF13676 TIR_2	3.1e-05	36.0	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263326	0.991	Interleukin-37
2	9606.ENSP00000376896	0.948	Interleukin-36 receptor antagonist protein
3	9606.ENSP00000363089	0.946	Toll-like receptor 4
4	9606.ENSP00000264657	0.925	Signal transducer and activator of transcription 3
5	9606.ENSP00000329967	0.909	Serine/threonine-protein kinase TBK1
6	9606.ENSP00000401399	0.776	Myeloid differentiation primary response protein MyD88
7	9606.ENSP00000261233	0.764	Interleukin-1 receptor-associated kinase 3
8	9606.ENSP00000314733	0.763	Toll-interacting protein
9	9606.ENSP00000370842	0.743	Interleukin-33
10	9606.ENSP00000433623	0.718	TNF receptor-associated factor 6
11	9606.ENSP00000387211	0.712	Interleukin-18 receptor 1
12	9606.ENSP00000358997	0.711	Interleukin-1 receptor-associated kinase 1
13	9606.ENSP00000344996	0.701	Paralemmin-3
14	9606.ENSP00000332788	0.673	Anoctamin-9
15	9606.ENSP00000376893	0.669	Interleukin-1 family member 10
16	9606.ENSP00000263174	0.623	Palmdelphin
17	9606.ENSP00000295927	0.587	Pentraxin-related protein PTX3
18	9606.ENSP00000353874	0.574	Toll-like receptor 9
19	9606.ENSP00000373169	0.561	D(3) dopamine receptor
20	9606.ENSP00000260010	0.559	Toll-like receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.648	signaling receptor activity
GO:0005102	0.348	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.988	negative regulation of biological process
GO:0010468	0.987	regulation of gene expression
GO:0009966	0.987	regulation of signal transduction
GO:0032101	0.983	regulation of response to external stimulus
GO:0048585	0.982	negative regulation of response to stimulus
GO:0048523	0.973	negative regulation of cellular process
GO:0050896	0.938	response to stimulus
GO:0023057	0.937	negative regulation of signaling
GO:0010648	0.919	negative regulation of cell communication
GO:0002831	0.863	regulation of response to biotic stimulus
GO:0051239	0.858	regulation of multicellular organismal process
GO:0009968	0.858	negative regulation of signal transduction
GO:0009987	0.838	cellular process
GO:0048518	0.786	positive regulation of biological process
GO:0001817	0.779	regulation of cytokine production
GO:0065009	0.778	regulation of molecular function
GO:0051090	0.766	regulation of DNA-binding transcription factor activity
GO:0051716	0.719	cellular response to stimulus
GO:0023052	0.657	signaling
GO:0007154	0.657	cell communication
GO:0007165	0.654	signal transduction
GO:0009892	0.640	negative regulation of metabolic process
GO:0080134	0.637	regulation of response to stress
GO:0002376	0.582	immune system process
GO:0010605	0.535	negative regulation of macromolecule metabolic process
GO:0006950	0.523	response to stress
GO:0031347	0.506	regulation of defense response
GO:0006952	0.500	defense response
GO:0002682	0.479	regulation of immune system process
GO:0048584	0.454	positive regulation of response to stimulus
GO:0044092	0.419	negative regulation of molecular function
GO:0002684	0.346	positive regulation of immune system process
GO:0009893	0.340	positive regulation of metabolic process
GO:0050776	0.339	regulation of immune response
GO:0032102	0.329	negative regulation of response to external stimulus
GO:0010604	0.311	positive regulation of macromolecule metabolic process
GO:0051707	0.300	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043227	0.888	membrane-bounded organelle
GO:0005622	0.815	intracellular anatomical structure
GO:0043231	0.782	intracellular membrane-bounded organelle
GO:0005737	0.747	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]