StarFunc result for job id Q6IA86

User Input

>input (826 residues)
MVAPVLETSHVFCCPNRVRGVLNWSSGPRGLLAFGTSCSVVLYDPLKRVVVTNLNGHTAR
VNCIQWICKQDGSPSTELVSGGSDNQVIHWEIEDNQLLKAVHLQGHEGPVYAVHAVYQRR
TSDPALCTLIVSAAADSAVRLWSKKGPEVMCLQTLNFGNGFALALCLSFLPNTDVPILAC
GNDDCRIHIFAQQNDQFQKVLSLCGHEDWIRGVEWAAFGRDLFLASCSQDCLIRIWKLYI
KSTSLETQDDDNIRLKENTFTIENESVKIAFAVTLETVLAGHENWVNAVHWQPVFYKDGV
LQQPVRLLSASMDKTMILWAPDEESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHA
FHGALHLWKQNTVNPREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLFAPWKR
KDQSQVTWHEIARPQIHGYDLKCLAMINRFQFVSGADEKVLRVFSAPRNFVENFCAITGQ
SLNHVLCNQDSDLPEGATVPALGLSNKAVFQGDIASQPSDEEELLTSTGFEYQQVAFQPS
ILTEPPTEDHLLQNTLWPEVQKLYGHGYEIFCVTCNSSKTLLASACKAAKKEHAAIILWN
TTSWKQVQNLVFHSLTVTQMAFSPNEKFLLAVSRDRTWSLWKKQDTISPEFEPVFSLFAF
TNKITSVHSRIIWSCDWSPDSKYFFTGSRDKKVVVWGECDSTDDCIEHNIGPCSSVLDVG
GAVTAVSVCPVLHPSQRYVVAVGLECGKICLYTWKKTDQVPEINDWTHCVETSQSQSHTL
AIRKLCWKNCSGKTEQKEAEGAEWLHFASCGEDHTVKIHRVNKCAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IA86	1.000	1.000	0.000	826	1.000	1.000	Q6IA86.pdb.gz	ELP2_HUMAN Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2 PE=1 SV=2
2	AFDB:Q91WG4	0.972	0.966	0.000	831	0.785	0.780	Q91WG4.pdb.gz	ELP2_MOUSE Elongator complex protein 2 OS=Mus musculus OX=10090 GN=Elp2 PE=1 SV=1
3	AFDB:F4I1S8	0.836	0.822	7.324E-69	840	0.343	0.337	F4I1S8.pdb.gz	F4I1S8_ARATH Elongator complex protein 2 OS=Arabidopsis thaliana OX=3702 GN=ELP2 PE=1 SV=1
4	AFDB:P42935	0.844	0.883	2.598E-64	788	0.293	0.307	P42935.pdb.gz	ELP2_YEAST Elongator complex protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELP2 PE=1 SV=1
5	AFDB:O94533	0.807	0.874	9.084E-64	760	0.292	0.317	O94533.pdb.gz	ELP2_SCHPO Elongator complex protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp2 PE=3 SV=1
6	PDB:6qk7B	0.820	0.902	6.683E-58	749	0.289	0.319	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
7	PDB:5m2nA	0.783	0.906	2.601E-53	711	0.271	0.315	5m2nA.pdb.gz
8	AFDB:Q5TDG3	0.482	0.434	3.734E-25	943	0.140	0.123	Q5TDG3.pdb.gz	Q5TDG3_HUMAN WD repeat domain 3, isoform CRA_b OS=Homo sapiens OX=9606 GN=WDR3 PE=2 SV=1
9	PDB:7mqaLQ	0.490	0.489	7.989E-25	830	0.134	0.134	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	AFDB:P87177	0.481	0.441	1.432E-24	922	0.130	0.116	P87177.pdb.gz	YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3D6.12 PE=1 SV=1
11	AFDB:Q5A756	0.463	0.405	2.498E-24	981	0.127	0.107	Q5A756.pdb.gz	Q5A756_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DIP2 PE=4 SV=1
12	PDB:7mqaLO	0.555	0.559	3.864E-24	819	0.123	0.125	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:Q9LFE2	0.458	0.437	5.008E-24	876	0.142	0.134	Q9LFE2.pdb.gz	TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE OS=Arabidopsis thaliana OX=3702 GN=TOZ PE=1 SV=1
14	AFDB:Q9LVF2	0.477	0.424	5.494E-24	955	0.133	0.115	Q9LVF2.pdb.gz	Q9LVF2_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At3g21540 PE=1 SV=1
15	PDB:7mq8LR	0.442	0.466	1.957E-23	773	0.133	0.142	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7mq8LO	0.526	0.515	6.842E-23	848	0.128	0.125	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8LT	0.473	0.454	6.332E-22	869	0.103	0.098	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7ajuUL	0.445	0.464	6.633E-22	779	0.128	0.136	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7d5sB2	0.353	0.346	1.212E-21	851	0.131	0.127	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:7ajtUA	0.522	0.518	2.429E-21	834	0.122	0.121	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IA86	0.0	1713	826	1.000	1.000	ELP2_HUMAN Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2 PE=1 SV=2
2	Q91WG4	0.0	1366	831	0.792	0.787	ELP2_MOUSE Elongator complex protein 2 OS=Mus musculus OX=10090 GN=Elp2 PE=1 SV=1
3	F4I1S8	2.02e-131	414	840	0.364	0.358	F4I1S8_ARATH Elongator complex protein 2 OS=Arabidopsis thaliana OX=3702 GN=ELP2 PE=1 SV=1
4	F4I1S7	5.24e-131	413	838	0.363	0.358	ELP2_ARATH Elongator complex protein 2 OS=Arabidopsis thaliana OX=3702 GN=ELP2 PE=1 SV=1
5	P42935	2.57e-110	357	788	0.293	0.307	ELP2_YEAST Elongator complex protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELP2 PE=1 SV=1
6	O94533	2.12e-104	341	760	0.300	0.326	ELP2_SCHPO Elongator complex protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp2 PE=3 SV=1
7	Q57YK0	2.30e-11	69.7	638	0.126	0.163	Q57YK0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.880 PE=4 SV=1
8	O74855	4.50e-10	65.5	502	0.115	0.189	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
9	Q9VPR4	1.90e-09	63.2	488	0.108	0.182	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
10	Q99KN2	8.94e-09	60.5	339	0.096	0.233	CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus OX=10090 GN=Ciao1 PE=1 SV=1
11	O76071	9.02e-09	60.5	339	0.093	0.227	CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
12	Q9FLX9	1.16e-08	60.8	473	0.115	0.201	NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana OX=3702 GN=NLE1 PE=2 SV=1
13	O18402	1.21e-07	57.4	478	0.057	0.098	O18402_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
14	Q9W4H9	1.21e-07	57.4	478	0.057	0.098	Q9W4H9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
15	Q5B563	2.92e-07	55.5	309	0.081	0.217	SEC13_EMENI Protein transport protein sec13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sec13 PE=3 SV=1
16	Q8VEJ4	3.03e-07	56.2	485	0.091	0.155	NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus OX=10090 GN=Nle1 PE=1 SV=4
17	O94319	3.28e-07	55.1	297	0.077	0.215	SEC13_SCHPO Protein transport protein sec13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec13 PE=1 SV=1
18	Q9NVX2	4.40e-07	55.8	485	0.091	0.155	NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=4
19	O80990	5.44e-07	55.1	352	0.091	0.213	CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana OX=3702 GN=CIA1 PE=1 SV=2
20	P25382	5.67e-07	55.5	515	0.093	0.150	NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSA4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.26	22.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF14354 Lar_restr_allev	37	16.0	Restriction alleviation protein Lar
3	PF00400 WD40	4.3e-30	114.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000040690

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000034434	0.994	Elongator complex protein 3
2	9598.ENSPTRP00000036274	0.987	Uncharacterized protein
3	9598.ENSPTRP00000048189	0.980	Elongator acetyltransferase complex subunit 4
4	9598.ENSPTRP00000025309	0.819	Diphthamide biosynthesis 3
5	9598.ENSPTRP00000014578	0.767	DPH1 homolog
6	9598.ENSPTRP00000001997	0.757	Uncharacterized protein
7	9598.ENSPTRP00000036629	0.736	Ubiquitin-related modifier 1
8	9598.ENSPTRP00000045721	0.730	NOP2/Sun RNA methyltransferase family, member 2
9	9598.ENSPTRP00000024042	0.727	Uncharacterized protein
10	9598.ENSPTRP00000029316	0.726	Uncharacterized protein
11	9598.ENSPTRP00000023439	0.717	Adenylyltransferase and sulfurtransferase MOCS3
12	9598.ENSPTRP00000028013	0.711	RNA (Guanine-9-) methyltransferase domain containing 2
13	9598.ENSPTRP00000047669	0.709	AlkB, alkylation repair homolog 8
14	9598.ENSPTRP00000014428	0.708	Cytoplasmic tRNA 2-thiolation protein 2
15	9598.ENSPTRP00000036998	0.694	Diphthamide biosynthesis 7
16	9598.ENSPTRP00000025653	0.691	Chromosome 3 open reading frame 75
17	9598.ENSPTRP00000040848	0.689	Uncharacterized protein
18	9598.ENSPTRP00000060977	0.689	Uncharacterized protein
19	9598.ENSPTRP00000019540	0.683	Cytoplasmic tRNA 2-thiolation protein 1
20	9598.ENSPTRP00000001738	0.677	DPH5 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0070063	0.885	RNA polymerase binding
GO:0043175	0.884	RNA polymerase core enzyme binding
GO:0001098	0.869	basal transcription machinery binding
GO:0001099	0.852	basal RNA polymerase II transcription machinery binding
GO:0000993	0.820	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0044237	0.985	cellular metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0080090	0.913	regulation of primary metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0010468	0.890	regulation of gene expression
GO:0034641	0.871	cellular nitrogen compound metabolic process
GO:1901360	0.866	organic cyclic compound metabolic process
GO:0046483	0.861	heterocycle metabolic process
GO:0006139	0.845	nucleobase-containing compound metabolic process
GO:0031323	0.833	regulation of cellular metabolic process
GO:0090304	0.822	nucleic acid metabolic process
GO:0016070	0.806	RNA metabolic process
GO:0010467	0.776	gene expression
GO:0019219	0.771	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.659	regulation of cellular biosynthetic process
GO:0010556	0.628	regulation of macromolecule biosynthetic process
GO:0051252	0.615	regulation of RNA metabolic process
GO:0044249	0.607	cellular biosynthetic process
GO:0006354	0.560	DNA-templated transcription elongation
GO:0006368	0.536	transcription elongation by RNA polymerase II
GO:2001141	0.525	regulation of RNA biosynthetic process
GO:0006357	0.506	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.990	cytosol
GO:1902494	0.952	catalytic complex
GO:0140513	0.850	nuclear protein-containing complex
GO:0140535	0.807	intracellular protein-containing complex
GO:0033588	0.743	elongator holoenzyme complex
GO:0008023	0.628	transcription elongation factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]