StarFunc result for job id Q6IB77

User Input

>input (296 residues)
MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCP
QEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA
IKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPNGGKPKAINQEMFKLSSMDVTHAHL
VNKFWHFGGNERSQRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLH
GLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IB77	1.000	1.000	1.247E-65	296	1.000	1.000	Q6IB77.pdb.gz	GLYAT_HUMAN Glycine N-acyltransferase OS=Homo sapiens OX=9606 GN=GLYAT PE=1 SV=3
2	AFDB:Q91XE0	0.986	0.986	1.189E-52	296	0.726	0.726	Q91XE0.pdb.gz	GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus OX=10090 GN=Glyat PE=1 SV=1
3	AFDB:Q2KIR7	0.974	0.977	3.650E-50	295	0.750	0.753	Q2KIR7.pdb.gz	GLYAT_BOVIN Glycine N-acyltransferase OS=Bos taurus OX=9913 GN=GLYAT PE=1 SV=2
4	AFDB:Q5FW57	0.979	0.979	2.320E-49	296	0.686	0.686	Q5FW57.pdb.gz	GLYAL_MOUSE Glycine N-acyltransferase-like protein OS=Mus musculus OX=10090 GN=Gm4952 PE=1 SV=3
5	PDB:7pk1A	0.955	0.981	9.640E-49	288	0.750	0.771	7pk1A.pdb.gz
6	AFDB:Q9DCY0	0.955	0.958	7.119E-47	295	0.622	0.624	Q9DCY0.pdb.gz	KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus OX=10090 GN=Keg1 PE=1 SV=1
7	AFDB:Q9Z2Y0	0.957	0.960	8.215E-46	295	0.622	0.624	Q9Z2Y0.pdb.gz	KEG1_RAT Glycine N-acyltransferase-like protein Keg1 OS=Rattus norvegicus OX=10116 GN=Keg1 PE=1 SV=2
8	AFDB:Q969I3	0.887	0.869	2.980E-36	302	0.395	0.387	Q969I3.pdb.gz	GLYL1_HUMAN Glycine N-acyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=GLYATL1 PE=1 SV=1
9	AFDB:Q8WU03	0.877	0.883	9.479E-35	294	0.416	0.418	Q8WU03.pdb.gz	GLYL2_HUMAN Glycine N-acyltransferase-like protein 2 OS=Homo sapiens OX=9606 GN=GLYATL2 PE=1 SV=1
10	AFDB:E9Q5L8	0.869	0.887	1.161E-28	290	0.301	0.307	E9Q5L8.pdb.gz	GLYL3_MOUSE Glycine-N-acyltransferase-like protein 3 OS=Mus musculus OX=10090 GN=Glyatl3 PE=1 SV=1
11	AFDB:Q22371	0.719	0.717	5.540E-15	297	0.142	0.141	Q22371.pdb.gz	Q22371_CAEEL Glycine N-acyltransferase-like protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B10.4 PE=1 SV=3
12	PDB:2wpwA	0.526	0.491	1.553E-8	328	0.132	0.119	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
13	PDB:2c27A	0.486	0.480	6.272E-7	301	0.122	0.120	2c27A.pdb.gz	The Substrate-Induced Conformational Change of Mycobacterium Tuberculosis Mycothiol Synthase.
14	PDB:4ii9A	0.459	0.418	2.754E-4	337	0.122	0.107	4ii9A.pdb.gz	The Structure of FemXWv in Complex with a Peptidyl-RNA Conjugate: Mechanism of Aminoacyl Transfer from Ala-tRNA(Ala) to Peptidoglycan Precursors
15	PDB:6tdfA	0.312	0.524	1.378E-3	165	0.064	0.115	6tdfA.pdb.gz	Targeting a critical step in fungal hexosamine biosynthesis.
16	PDB:2p6eC	0.347	0.254	1.463E-3	446	0.081	0.054	2p6eC.pdb.gz	Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
17	PDB:3t90A	0.293	0.540	1.463E-3	147	0.054	0.109	3t90A.pdb.gz
18	PDB:4e8oB	0.329	0.606	2.358E-3	148	0.047	0.095	4e8oB.pdb.gz
19	PDB:6yugA	0.279	0.525	2.358E-3	143	0.068	0.140	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
20	PDB:1s5kA	0.345	0.627	2.657E-3	153	0.068	0.131	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IB77	0.0	624	296	1.000	1.000	GLYAT_HUMAN Glycine N-acyltransferase OS=Homo sapiens OX=9606 GN=GLYAT PE=1 SV=3
2	Q91XE0	1.41e-166	466	296	0.726	0.726	GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus OX=10090 GN=Glyat PE=1 SV=1
3	Q2KIR7	6.15e-166	464	295	0.753	0.756	GLYAT_BOVIN Glycine N-acyltransferase OS=Bos taurus OX=9913 GN=GLYAT PE=1 SV=2
4	Q5FW57	4.88e-154	434	296	0.689	0.689	GLYAL_MOUSE Glycine N-acyltransferase-like protein OS=Mus musculus OX=10090 GN=Gm4952 PE=1 SV=3
5	Q9Z2Y0	6.76e-139	395	295	0.625	0.627	KEG1_RAT Glycine N-acyltransferase-like protein Keg1 OS=Rattus norvegicus OX=10116 GN=Keg1 PE=1 SV=2
6	Q9DCY0	5.17e-138	393	295	0.622	0.624	KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus OX=10090 GN=Keg1 PE=1 SV=1
7	Q8WU03	1.70e-75	234	294	0.412	0.415	GLYL2_HUMAN Glycine N-acyltransferase-like protein 2 OS=Homo sapiens OX=9606 GN=GLYATL2 PE=1 SV=1
8	Q969I3	3.54e-75	234	302	0.399	0.391	GLYL1_HUMAN Glycine N-acyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=GLYATL1 PE=1 SV=1
9	E9Q5L8	2.81e-46	159	290	0.321	0.328	GLYL3_MOUSE Glycine-N-acyltransferase-like protein 3 OS=Mus musculus OX=10090 GN=Glyatl3 PE=1 SV=1
10	O07838	0.55	34.3	440	0.054	0.036	DCTM_RHOCA C4-dicarboxylate TRAP transporter large permease protein DctM OS=Rhodobacter capsulatus OX=1061 GN=dctM PE=1 SV=1
11	Q9VQK5	1.0	33.5	806	0.098	0.036	Q9VQK5_DROME LD24714p OS=Drosophila melanogaster OX=7227 GN=Prp40 PE=1 SV=1
12	A6MUT4	1.3	32.7	291	0.105	0.107	A6MUT4_GOSHI GDP-mannose pyrophosphorylase (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=1
13	O57400	2.2	32.3	672	0.159	0.070	O57400_CHICK Protein-arginine deiminase OS=Gallus gallus OX=9031 PE=2 SV=1
14	F1M3G7	2.3	32.3	2760	0.044	0.005	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
15	A8SZH4	2.9	32.0	1074	0.091	0.025	A8SZH4_SALSA Toll-like receptor 9 OS=Salmo salar OX=8030 GN=TLR9 PE=2 SV=1
16	Q3E841	3.3	30.0	98	0.061	0.184	YN034_YEAST Uncharacterized protein YNR034W-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR034W-A PE=1 SV=1
17	P19735	4.4	31.6	899	0.051	0.017	PRP6_YEAST Pre-mRNA-splicing factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP6 PE=1 SV=1
18	P25870	6.4	31.2	1694	0.095	0.017	CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum OX=44689 GN=chcA PE=1 SV=1
19	Q9TW28	6.5	31.2	1737	0.088	0.015	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
20	P13699	6.6	30.8	569	0.115	0.060	NCAP_LASSJ Nucleoprotein OS=Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) OX=11622 GN=N PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08445 FR47	5.1e+02	12.0	FR47-like protein
2	PF08444 Gly_acyl_tr_C	3.1e-42	154.0	Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
3	PF06021 Gly_acyl_tr_N	3.5e-89	309.8	Aralkyl acyl-CoA:amino acid N-acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484592

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259407	0.819	Bile acid-CoA:amino acid N-acyltransferase
2	9606.ENSP00000228476	0.607	D-amino-acid oxidase
3	9606.ENSP00000402608	0.551	Carbamoyl-phosphate synthase [ammonia], mitochondrial
4	9606.ENSP00000238379	0.530	Haloacid dehalogenase like hydrolase domain containing 3
5	9606.ENSP00000267273	0.501	Protein-lysine methyltransferase METTL21C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016747	1.000	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0005488	0.997	binding
GO:0016410	0.993	N-acyltransferase activity
GO:0005515	0.992	protein binding
GO:0047962	0.975	glycine N-benzoyltransferase activity
GO:0047961	0.582	glycine N-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901605	0.990	alpha-amino acid metabolic process
GO:0009069	0.976	serine family amino acid metabolic process
GO:1901360	0.957	organic cyclic compound metabolic process
GO:0006544	0.955	glycine metabolic process
GO:0034641	0.954	cellular nitrogen compound metabolic process
GO:0006725	0.948	cellular aromatic compound metabolic process
GO:0055086	0.920	nucleobase-containing small molecule metabolic process
GO:0006790	0.915	sulfur compound metabolic process
GO:0009259	0.854	ribonucleotide metabolic process
GO:0033865	0.814	nucleoside bisphosphate metabolic process
GO:0009150	0.786	purine ribonucleotide metabolic process
GO:0033875	0.767	ribonucleoside bisphosphate metabolic process
GO:0034032	0.664	purine nucleoside bisphosphate metabolic process
GO:0043603	0.501	amide metabolic process
GO:0035383	0.469	thioester metabolic process
GO:0050896	0.399	response to stimulus
GO:0006805	0.346	xenobiotic metabolic process
GO:0006637	0.307	acyl-CoA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.965	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:18493	0.975	benzoyl-CoA + glycine = CoA + H(+) + N-benzoylglycine
EC:2.3.1.71	0.975	glycine N-benzoyltransferase.
RHEA:19869	0.582	an acyl-CoA + glycine = an N-acylglycine + CoA + H(+)
EC:2.3.1.13	0.582	glycine N-acyltransferase.

[back to server]