StarFunc result for job id Q6IBS0

User Input

>input (349 residues)
MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPL
LDAQQPCYLLYRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDE
LFGTVKDDLSFAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAF
PLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVPRDAARYHFFL
YKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLLDSVEQDFHLEIAKKIEIGDG
AELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IBS0	1.000	1.000	1.478E-73	349	1.000	1.000	Q6IBS0.pdb.gz	TWF2_HUMAN Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2
2	AFDB:Q12792	0.557	0.556	9.926E-56	350	0.645	0.643	Q12792.pdb.gz	TWF1_HUMAN Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3
3	PDB:7cccB	0.958	0.977	1.148E-54	342	0.642	0.655	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
4	AFDB:Q9VFM9	0.967	0.984	6.980E-50	343	0.490	0.499	Q9VFM9.pdb.gz	TWF_DROME Twinfilin OS=Drosophila melanogaster OX=7227 GN=twf PE=1 SV=1
5	AFDB:F8VS81	0.675	0.804	2.487E-37	291	0.436	0.522	F8VS81.pdb.gz	F8VS81_HUMAN Twinfilin actin binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=1
6	AFDB:O94399	0.821	0.870	2.108E-25	328	0.226	0.241	O94399.pdb.gz	TWF1_SCHPO Twinfilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=twf1 PE=1 SV=1
7	AFDB:P53250	0.751	0.786	6.601E-21	332	0.244	0.256	P53250.pdb.gz	TWF1_YEAST Twinfilin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TWF1 PE=1 SV=1
8	AFDB:Q584F2	0.654	0.706	2.393E-19	320	0.163	0.178	Q584F2.pdb.gz	Q584F2_TRYB2 G-actin binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.700 PE=3 SV=1
9	AFDB:Q75JY8	0.316	0.217	3.061E-13	522	0.132	0.088	Q75JY8.pdb.gz	Q75JY8_DICDI ADF-H domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277615 PE=4 SV=1
10	AFDB:Q39251	0.322	0.774	1.250E-11	137	0.112	0.285	Q39251.pdb.gz	ADF2_ARATH Actin-depolymerizing factor 2 OS=Arabidopsis thaliana OX=3702 GN=ADF2 PE=1 SV=1
11	AFDB:Q9LQ81	0.323	0.759	1.409E-11	140	0.106	0.264	Q9LQ81.pdb.gz	ADF10_ARATH Actin-depolymerizing factor 10 OS=Arabidopsis thaliana OX=3702 GN=ADF10 PE=2 SV=1
12	PDB:1v6fA	0.350	0.760	1.493E-9	151	0.095	0.219	1v6fA.pdb.gz
13	PDB:1cofA	0.318	0.778	2.409E-9	135	0.080	0.207	1cofA.pdb.gz
14	PDB:2i2qA	0.286	0.762	5.911E-9	122	0.074	0.213	2i2qA.pdb.gz
15	PDB:1wfsA	0.357	0.773	1.287E-8	151	0.097	0.225	1wfsA.pdb.gz
16	PDB:2mv2A	0.320	0.692	5.095E-8	148	0.074	0.176	2mv2A.pdb.gz
17	PDB:2lxxA	0.318	0.678	8.224E-8	152	0.080	0.184	2lxxA.pdb.gz
18	PDB:2lj8A	0.314	0.733	1.790E-7	136	0.072	0.184	2lj8A.pdb.gz
19	PDB:2xf1A	0.270	0.698	9.007E-7	122	0.049	0.139	2xf1A.pdb.gz
20	PDB:1tvjA	0.326	0.637	2.210E-6	166	0.069	0.145	1tvjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IBS0	0.0	724	349	1.000	1.000	TWF2_HUMAN Twinfilin-2 OS=Homo sapiens OX=9606 GN=TWF2 PE=1 SV=2
2	Q9Z0P5	0.0	705	349	0.966	0.966	TWF2_MOUSE Twinfilin-2 OS=Mus musculus OX=10090 GN=Twf2 PE=1 SV=1
3	Q91YR1	2.59e-180	504	350	0.656	0.654	TWF1_MOUSE Twinfilin-1 OS=Mus musculus OX=10090 GN=Twf1 PE=1 SV=2
4	Q12792	1.18e-179	503	350	0.645	0.643	TWF1_HUMAN Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3
5	Q9VFM9	7.56e-123	358	343	0.490	0.499	TWF_DROME Twinfilin OS=Drosophila melanogaster OX=7227 GN=twf PE=1 SV=1
6	F8VS81	2.50e-117	343	291	0.436	0.522	F8VS81_HUMAN Twinfilin actin binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=1
7	O94399	8.72e-20	90.9	328	0.226	0.241	TWF1_SCHPO Twinfilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=twf1 PE=1 SV=1
8	P53250	6.92e-18	85.5	332	0.238	0.250	TWF1_YEAST Twinfilin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TWF1 PE=1 SV=1
9	Q39251	6.00e-10	58.9	137	0.117	0.299	ADF2_ARATH Actin-depolymerizing factor 2 OS=Arabidopsis thaliana OX=3702 GN=ADF2 PE=1 SV=1
10	Q67ZM4	1.44e-09	57.8	137	0.117	0.299	ADF7_ARATH Actin-depolymerizing factor 7 OS=Arabidopsis thaliana OX=3702 GN=ADF7 PE=2 SV=1
11	A1XJ44	4.38e-08	53.9	139	0.126	0.317	A1XJ44_GOSHI Actin depolymerizing factor 7 OS=Gossypium hirsutum OX=3635 GN=ADF7 PE=2 SV=1
12	Q8LFH6	8.96e-08	52.8	137	0.103	0.263	ADF12_ARATH Actin-depolymerizing factor 12 OS=Arabidopsis thaliana OX=3702 GN=ADF12 PE=2 SV=2
13	Q9LQ81	1.51e-07	52.4	140	0.103	0.257	ADF10_ARATH Actin-depolymerizing factor 10 OS=Arabidopsis thaliana OX=3702 GN=ADF10 PE=2 SV=1
14	Q570Y6	2.35e-07	51.6	140	0.106	0.264	ADF8_ARATH Actin-depolymerizing factor 8 OS=Arabidopsis thaliana OX=3702 GN=ADF8 PE=2 SV=2
15	Q4JHK7	2.83e-07	51.2	139	0.109	0.273	Q4JHK7_GOSHI Actin depolymerizing factor OS=Gossypium hirsutum OX=3635 GN=ADF1 PE=2 SV=2
16	A8MR09	6.23e-06	47.8	150	0.097	0.227	A8MR09_ARATH Actin depolymerizing factor 1 OS=Arabidopsis thaliana OX=3702 GN=ADF1 PE=1 SV=1
17	A1XJ49	8.65e-06	47.0	139	0.092	0.230	A1XJ49_GOSHI Actin depolymerizing factor 6 OS=Gossypium hirsutum OX=3635 GN=ADF6 PE=2 SV=1
18	Q208T5	9.34e-06	47.0	139	0.092	0.230	Q208T5_GOSHI Actin depolymerizing factor 2 OS=Gossypium hirsutum OX=3635 GN=ADF2 PE=2 SV=1
19	A1XJ46	1.01e-05	47.0	139	0.080	0.201	A1XJ46_GOSHI Actin depolymerizing factor 3 OS=Gossypium hirsutum OX=3635 GN=ADF3 PE=2 SV=1
20	P78929	1.16e-05	46.6	137	0.083	0.212	COFI_SCHPO Cofilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cof1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00241 Cofilin_ADF	6.2e-37	137.5	Cofilin/tropomyosin-type actin-binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303908

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361883	0.892	Adenylyl cyclase-associated protein 1
2	9606.ENSP00000229922	0.873	Adenylyl cyclase-associated protein 2
3	9606.ENSP00000290378	0.814	Actin, alpha cardiac muscle 1
4	9606.ENSP00000349960	0.737	Actin, cytoplasmic 1
5	9606.ENSP00000261708	0.734	U3 small nucleolar RNA-associated protein 6 homolog
6	9606.ENSP00000402373	0.718	Actin, aortic smooth muscle
7	9606.ENSP00000265944	0.702	Myosin-IIIa
8	9606.ENSP00000367830	0.693	Protein kinase C zeta type
9	9606.ENSP00000367059	0.683	Espin
10	9606.ENSP00000354623	0.682	Whirlin
11	9606.ENSP00000290583	0.679	CUGBP Elav-like family member 3
12	9606.ENSP00000360821	0.679	Ubiquitin-associated domain-containing protein 1
13	9606.ENSP00000281172	0.676	Epidermal growth factor receptor kinase substrate 8
14	9606.ENSP00000401010	0.661	F-actin-capping protein subunit beta
15	9606.ENSP00000354947	0.644	F-actin-capping protein subunit alpha-2
16	9606.ENSP00000416015	0.643	[F-actin]-monooxygenase MICAL3
17	9606.ENSP00000306920	0.641	Beta-galactosidase
18	9606.ENSP00000386331	0.634	Unconventional myosin-VIIa
19	9606.ENSP00000358120	0.620	Pleckstrin homology domain-containing family O member 1
20	9606.ENSP00000427687	0.618	WD repeat-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043168	1.000	anion binding
GO:0003779	1.000	actin binding
GO:1901363	0.920	heterocyclic compound binding
GO:0097159	0.920	organic cyclic compound binding
GO:0036094	0.899	small molecule binding
GO:1901265	0.896	nucleoside phosphate binding
GO:0097367	0.891	carbohydrate derivative binding
GO:0000166	0.889	nucleotide binding
GO:0045296	0.862	cadherin binding
GO:0032555	0.859	purine ribonucleotide binding
GO:0035639	0.850	purine ribonucleoside triphosphate binding
GO:0032559	0.848	adenyl ribonucleotide binding
GO:0005524	0.841	ATP binding
GO:0008289	0.840	lipid binding
GO:0005543	0.829	phospholipid binding
GO:0003785	0.826	actin monomer binding
GO:1902936	0.773	phosphatidylinositol bisphosphate binding
GO:0005546	0.763	phosphatidylinositol-4,5-bisphosphate binding
GO:0044877	0.712	protein-containing complex binding
GO:0051015	0.599	actin filament binding
GO:0019899	0.347	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0090066	0.997	regulation of anatomical structure size
GO:0050789	0.995	regulation of biological process
GO:0032970	0.993	regulation of actin filament-based process
GO:0044087	0.992	regulation of cellular component biogenesis
GO:0051493	0.992	regulation of cytoskeleton organization
GO:0032535	0.991	regulation of cellular component size
GO:0120035	0.989	regulation of plasma membrane bounded cell projection organization
GO:0032956	0.980	regulation of actin cytoskeleton organization
GO:0048519	0.932	negative regulation of biological process
GO:0051129	0.919	negative regulation of cellular component organization
GO:0051179	0.814	localization
GO:0048518	0.653	positive regulation of biological process
GO:0051641	0.600	cellular localization
GO:0110053	0.536	regulation of actin filament organization
GO:0010639	0.523	negative regulation of organelle organization
GO:0008064	0.504	regulation of actin polymerization or depolymerization
GO:0043254	0.479	regulation of protein-containing complex assembly
GO:0050896	0.433	response to stimulus
GO:0048522	0.403	positive regulation of cellular process
GO:1902904	0.399	negative regulation of supramolecular fiber organization
GO:0051494	0.399	negative regulation of cytoskeleton organization
GO:0030833	0.396	regulation of actin filament polymerization
GO:0031333	0.387	negative regulation of protein-containing complex assembly
GO:0030837	0.384	negative regulation of actin filament polymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0042995	0.997	cell projection
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0043227	0.986	membrane-bounded organelle
GO:0120025	0.984	plasma membrane bounded cell projection
GO:0005829	0.983	cytosol
GO:0005576	0.979	extracellular region
GO:1903561	0.956	extracellular vesicle
GO:0070062	0.951	extracellular exosome
GO:0071944	0.848	cell periphery
GO:0016020	0.840	membrane
GO:0043005	0.820	neuron projection
GO:0005886	0.810	plasma membrane
GO:0005856	0.728	cytoskeleton
GO:0043231	0.717	intracellular membrane-bounded organelle
GO:0015629	0.669	actin cytoskeleton
GO:0099512	0.541	supramolecular fiber
GO:0031252	0.513	cell leading edge
GO:0098858	0.453	actin-based cell projection
GO:0043292	0.428	contractile fiber
GO:0030016	0.411	myofibril
GO:0012505	0.389	endomembrane system
GO:0048471	0.326	perinuclear region of cytoplasm
GO:0070013	0.316	intracellular organelle lumen
GO:0030424	0.307	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]