StarFunc result for job id Q6ICB0

User Input

>input (168 residues)
MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPP
GGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLT
GRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ICB0	1.000	1.000	1.192E-36	168	1.000	1.000	Q6ICB0.pdb.gz	DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens OX=9606 GN=DESI1 PE=1 SV=1
2	PDB:2wp7A	0.934	0.992	4.750E-30	158	0.911	0.968	2wp7A.pdb.gz
3	AFDB:Q9SFT9	0.837	0.537	2.606E-19	265	0.446	0.283	Q9SFT9.pdb.gz	Q9SFT9_ARATH PPPDE putative thiol peptidase family protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.26 PE=1 SV=1
4	AFDB:Q38FI8	0.838	0.137	5.593E-17	1051	0.387	0.062	Q38FI8.pdb.gz	Q38FI8_TRYB2 mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2050 PE=3 SV=1
5	AFDB:Q381Y2	0.829	0.240	3.575E-13	596	0.298	0.084	Q381Y2.pdb.gz	Q381Y2_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6150 PE=3 SV=1
6	AFDB:Q6DC39	0.682	0.590	1.311E-9	196	0.250	0.214	Q6DC39.pdb.gz	DESI2_DANRE Deubiquitinase DESI2 OS=Danio rerio OX=7955 GN=desi2 PE=2 SV=1
7	AFDB:Q9BSY9	0.713	0.624	1.785E-9	194	0.268	0.232	Q9BSY9.pdb.gz	DESI2_HUMAN Deubiquitinase DESI2 OS=Homo sapiens OX=9606 GN=DESI2 PE=1 SV=1
8	AFDB:Q385N7	0.707	0.203	3.906E-8	656	0.202	0.052	Q385N7.pdb.gz	Q385N7_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2980 PE=3 SV=1
9	AFDB:Q382J0	0.672	0.492	9.267E-8	236	0.238	0.169	Q382J0.pdb.gz	Q382J0_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5070 PE=3 SV=1
10	AFDB:Q8X1T0	0.643	0.546	1.342E-7	201	0.226	0.189	Q8X1T0.pdb.gz	SDU1_SCHPO DeSI-like protein sdu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdu1 PE=1 SV=1
11	AFDB:Q382J5	0.628	0.343	8.916E-6	334	0.232	0.117	Q382J5.pdb.gz	Q382J5_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5020 PE=3 SV=1
12	PDB:7bxtM	0.083	0.075	1.728	198	0.065	0.056	7bxtM.pdb.gz	Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.
13	PDB:6e8nA	0.145	0.134	1.838	185	0.024	0.022	6e8nA.pdb.gz
14	PDB:4frxB	0.073	0.040	2.212	400	0.042	0.018	4frxB.pdb.gz	Crystal Structures of OccK Subfamily Proteins
15	PDB:3saoA	0.069	0.076	2.502	150	0.048	0.053	3saoA.pdb.gz	Galline Ex-FABP Is an Antibacterial Siderocalin and a Lysophosphatidic Acid Sensor Functioning through Dual Ligand Specificities.
16	PDB:1ee9A	0.085	0.057	2.831	317	0.048	0.025	1ee9A.pdb.gz	The X-ray structure of the NAD-dependent 5,10-methylenetetrahydrofolate dehydrogenase from Saccharomyces cerevisiae.
17	PDB:2x1gB	0.125	0.141	2.831	140	0.048	0.057	2x1gB.pdb.gz
18	PDB:6jlaD	0.144	0.130	2.831	188	0.042	0.037	6jlaD.pdb.gz	Structures of three ependymin-related proteins suggest their function as a hydrophobic molecule binder.
19	PDB:7t1iB	0.102	0.067	2.831	314	0.089	0.048	7t1iB.pdb.gz	High-resolution crystal structure and chemical screening reveal pantothenate kinase as a new target for antifungal development.
20	PDB:1oniA	0.134	0.158	3.011	136	0.095	0.118	1oniA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ICB0	3.15e-121	340	168	1.000	1.000	DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens OX=9606 GN=DESI1 PE=1 SV=1
2	Q9CQT7	8.32e-118	332	168	0.970	0.970	DESI1_MOUSE Desumoylating isopeptidase 1 OS=Mus musculus OX=10090 GN=Desi1 PE=1 SV=1
3	Q9SFT9	5.51e-43	145	265	0.429	0.272	Q9SFT9_ARATH PPPDE putative thiol peptidase family protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.26 PE=1 SV=1
4	Q38FI8	3.20e-32	123	1051	0.375	0.060	Q38FI8_TRYB2 mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2050 PE=3 SV=1
5	Q381Y2	1.67e-20	89.4	596	0.292	0.082	Q381Y2_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6150 PE=3 SV=1
6	Q6DC39	4.08e-11	60.8	196	0.226	0.194	DESI2_DANRE Deubiquitinase DESI2 OS=Danio rerio OX=7955 GN=desi2 PE=2 SV=1
7	Q9BSY9	4.54e-10	57.8	194	0.232	0.201	DESI2_HUMAN Deubiquitinase DESI2 OS=Homo sapiens OX=9606 GN=DESI2 PE=1 SV=1
8	Q9D291	4.97e-10	57.8	194	0.232	0.201	DESI2_MOUSE Deubiquitinase DESI2 OS=Mus musculus OX=10090 GN=Desi2 PE=1 SV=1
9	Q8X1T0	7.52e-05	43.5	201	0.196	0.164	SDU1_SCHPO DeSI-like protein sdu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sdu1 PE=1 SV=1
10	Q382J0	0.007	38.1	236	0.214	0.153	Q382J0_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5070 PE=3 SV=1
11	Q385N7	0.053	35.8	656	0.161	0.041	Q385N7_TRYB2 PPPDE domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2980 PE=3 SV=1
12	O95402	2.1	31.2	600	0.095	0.027	MED26_HUMAN Mediator of RNA polymerase II transcription subunit 26 OS=Homo sapiens OX=9606 GN=MED26 PE=1 SV=2
13	Q9C811	7.5	29.3	1495	0.083	0.009	NU160_ARATH Nuclear pore complex protein NUP160 OS=Arabidopsis thaliana OX=3702 GN=NUP160 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05903 Peptidase_C97	1.1e-40	150.4	PPPDE putative peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018924

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000909	0.678	Ubiquitin specific peptidase like 1
2	61853.ENSNLEP00000019112	0.639	Neuronal pentraxin I
3	61853.ENSNLEP00000022073	0.531	Ubiquilin-like
4	61853.ENSNLEP00000001267	0.527	Uncharacterized protein
5	61853.ENSNLEP00000012514	0.527	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.992	catalytic activity
GO:0140096	0.969	catalytic activity, acting on a protein
GO:0016787	0.960	hydrolase activity
GO:0019783	0.920	ubiquitin-like protein peptidase activity
GO:0008234	0.870	cysteine-type peptidase activity
GO:0042802	0.536	identical protein binding
GO:0061676	0.447	importin-alpha family protein binding
GO:0016929	0.326	deSUMOylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0009987	0.982	cellular process
GO:0080090	0.978	regulation of primary metabolic process
GO:0019538	0.976	protein metabolic process
GO:0036211	0.967	protein modification process
GO:0018193	0.964	peptidyl-amino acid modification
GO:0051246	0.963	regulation of protein metabolic process
GO:0050794	0.941	regulation of cellular process
GO:1903050	0.937	regulation of proteolysis involved in protein catabolic process
GO:0042176	0.924	regulation of protein catabolic process
GO:0061136	0.906	regulation of proteasomal protein catabolic process
GO:0018205	0.877	peptidyl-lysine modification
GO:0051641	0.876	cellular localization
GO:0070647	0.859	protein modification by small protein conjugation or removal
GO:0006508	0.851	proteolysis
GO:0031323	0.847	regulation of cellular metabolic process
GO:0006810	0.831	transport
GO:0051169	0.801	nuclear transport
GO:0051168	0.782	nuclear export
GO:0032434	0.725	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0045184	0.623	establishment of protein localization
GO:0015031	0.588	protein transport
GO:0006886	0.559	intracellular protein transport
GO:0070646	0.465	protein modification by small protein removal
GO:0006611	0.438	protein export from nucleus
GO:0048518	0.344	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0032991	0.996	protein-containing complex
GO:0005634	0.888	nucleus
GO:0031981	0.441	nuclear lumen
GO:0005654	0.420	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.960	Hydrolases.
EC:3.4.-.-	0.920	Acting on peptide bonds (peptidases).

[back to server]