StarFunc result for job id Q6ICL7

User Input

>input (350 residues)
MCRCPPEHHDGRMTSAEVGAAAGGAQAAGPPEWPPGSPQALRQPGRARVAMAALVWLLAG
ASMSSLNKWIFTVHGFGRPLLLSALHMLVAALACHRGARRPMPGGTRCRVLLLSLTFGTS
MACGNVGLRAVPLDLAQLVTTTTPLFTLALSALLLGRRHHPLQLAAMGPLCLGAACSLAG
EFRTPPTGCGFLLAATCLRGLKSVQQSALLQEERLDAVTLLYATSLPSFCLLAGAALVLE
AGVAPPPTAGDSRLWACILLSCLLSVLYNLASFSLLALTSALTVHVLGNLTVVGNLILSR
LLFGSRLSALSYVGIALTLSGMFLYHNCEFVASWAARRGLWRRDQPSKGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ICL7	1.000	1.000	6.822E-44	350	1.000	1.000	Q6ICL7.pdb.gz	S35E4_HUMAN Solute carrier family 35 member E4 OS=Homo sapiens OX=9606 GN=SLC35E4 PE=1 SV=1
2	AFDB:Q6DBP3	0.761	0.858	7.714E-15	309	0.243	0.275	Q6DBP3.pdb.gz	PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana OX=3702 GN=At5g05820 PE=2 SV=1
3	AFDB:Q9SFE9	0.755	0.774	2.804E-14	341	0.194	0.199	Q9SFE9.pdb.gz	GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana OX=3702 GN=GONST5 PE=2 SV=1
4	AFDB:Q9FYE5	0.759	0.856	7.225E-14	309	0.214	0.243	Q9FYE5.pdb.gz	UUAT1_ARATH UDP-URONIC ACID TRANSPORTER 1 OS=Arabidopsis thaliana OX=3702 GN=UUAT1 PE=1 SV=1
5	AFDB:Q8C811	0.687	0.603	2.862E-13	405	0.226	0.195	Q8C811.pdb.gz	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
6	AFDB:Q94B65	0.750	0.808	5.457E-13	323	0.177	0.192	Q94B65.pdb.gz	UTR7_ARATH UDP-galactose/UDP-glucose transporter 7 OS=Arabidopsis thaliana OX=3702 GN=UTR7 PE=1 SV=1
7	AFDB:Q8BGF8	0.713	0.599	5.570E-12	422	0.166	0.137	Q8BGF8.pdb.gz	S35D3_MOUSE Solute carrier family 35 member D3 OS=Mus musculus OX=10090 GN=Slc35d3 PE=1 SV=1
8	AFDB:Q585Z4	0.736	0.797	9.745E-12	322	0.191	0.208	Q585Z4.pdb.gz	Q585Z4_TRYB2 Sugar phosphate transporter domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.380 PE=4 SV=1
9	AFDB:Q10354	0.722	0.679	1.633E-11	374	0.217	0.203	Q10354.pdb.gz	YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22E12.01 PE=3 SV=2
10	AFDB:A2QDX9	0.699	0.623	3.542E-11	399	0.211	0.185	A2QDX9.pdb.gz	A2QDX9_ASPNC Contig An02c0270, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g08670 PE=4 SV=1
11	PDB:5ogeG	0.650	0.731	5.030E-9	306	0.114	0.131	5ogeG.pdb.gz
12	PDB:6xboA	0.533	0.575	5.125E-6	319	0.143	0.157	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
13	PDB:7ru6A	0.140	0.148	1.563E-1	315	0.126	0.140	7ru6A.pdb.gz	Antiviral HIV-1 SERINC restriction factors disrupt virus membrane asymmetry.
14	PDB:7lciR	0.140	0.127	1.778E-1	393	0.117	0.104	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
15	PDB:7cmhB	0.131	0.104	2.204E-1	458	0.146	0.111	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
16	PDB:4czbB	0.137	0.126	2.402E-1	419	0.143	0.119	4czbB.pdb.gz
17	PDB:7p9uB	0.171	0.146	2.508E-1	455	0.134	0.103	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
18	PDB:7tynR	0.144	0.137	3.110E-1	373	0.094	0.088	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
19	PDB:5y50A	0.170	0.142	3.694E-1	448	0.163	0.127	5y50A.pdb.gz
20	PDB:7p5cA	0.113	0.103	3.694E-1	392	0.123	0.110	7p5cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ICL7	0.0	683	350	1.000	1.000	S35E4_HUMAN Solute carrier family 35 member E4 OS=Homo sapiens OX=9606 GN=SLC35E4 PE=1 SV=1
2	Q6DBP3	6.06e-25	104	309	0.251	0.285	PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana OX=3702 GN=At5g05820 PE=2 SV=1
3	I1VCA5	6.48e-24	102	308	0.246	0.279	I1VCA5_ARATH Putative nucleotide-sugar transporter (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NST PE=2 SV=1
4	Q5XF09	6.48e-24	102	308	0.246	0.279	PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana OX=3702 GN=At3g11320 PE=2 SV=1
5	Q9FYE5	3.84e-17	83.2	309	0.209	0.236	UUAT1_ARATH UDP-URONIC ACID TRANSPORTER 1 OS=Arabidopsis thaliana OX=3702 GN=UUAT1 PE=1 SV=1
6	Q9SFE9	7.07e-17	82.8	341	0.209	0.214	GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana OX=3702 GN=GONST5 PE=2 SV=1
7	Q9C521	8.64e-17	82.4	336	0.206	0.214	UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana OX=3702 GN=UDP-GALT1 PE=2 SV=1
8	Q69VR7	1.26e-10	64.3	408	0.209	0.179	PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT1 PE=2 SV=1
9	Q84QU8	7.98e-10	62.0	407	0.254	0.219	PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT2 PE=2 SV=1
10	Q5B8L7	6.01e-09	59.3	400	0.220	0.193	Q5B8L7_EMENI DMT family organic anion transporter (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03113 PE=4 SV=1
11	Q8C811	1.21e-07	55.5	405	0.203	0.175	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
12	Q96K37	2.29e-07	54.3	410	0.151	0.129	S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
13	A2QDX9	1.32e-06	52.0	399	0.200	0.175	A2QDX9_ASPNC Contig An02c0270, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g08670 PE=4 SV=1
14	Q8RXN3	2.65e-06	51.2	408	0.166	0.142	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
15	Q94EI9	1.07e-05	48.9	340	0.191	0.197	PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana OX=3702 GN=At3g14410 PE=2 SV=1
16	Q94B65	1.35e-05	48.5	323	0.217	0.235	UTR7_ARATH UDP-galactose/UDP-glucose transporter 7 OS=Arabidopsis thaliana OX=3702 GN=UTR7 PE=1 SV=1
17	Q7Z769	2.18e-05	48.1	313	0.211	0.236	S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens OX=9606 GN=SLC35E3 PE=1 SV=1
18	Q5VQL3	2.73e-05	48.1	393	0.160	0.142	PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1
19	Q10354	4.86e-05	47.0	374	0.226	0.211	YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22E12.01 PE=3 SV=2
20	Q9SRE4	5.24e-05	47.0	347	0.083	0.084	URGT1_ARATH UDP-rhamnose/UDP-galactose transporter 1 OS=Arabidopsis thaliana OX=3702 GN=URGT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00892 EamA	6e-12	57.3	EamA-like transporter family
2	PF05653 Mg_trans_NIPA	1.4e+02	13.0	Magnesium transporter NIPA
3	PF03151 TPT	1.5e-19	82.1	Triose-phosphate Transporter family
4	PF08449 UAA	0.0026	28.6	UAA transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339626

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215838	0.746	Transcobalamin-2
2	9606.ENSP00000266086	0.699	Solute carrier family 5 member 4
3	9606.ENSP00000375810	0.683	Kinesin light chain 3
4	9606.ENSP00000306678	0.618	Ankyrin repeat and kinase domain containing 1
5	9606.ENSP00000421076	0.608	ATP synthase subunit g 2, mitochondrial
6	9606.ENSP00000348086	0.602	Protein FAM227A
7	9606.ENSP00000215770	0.596	D-dopachrome decarboxylase-like protein
8	9606.ENSP00000329647	0.594	Actin-like protein 10
9	9606.ENSP00000263847	0.584	Oxysterol-binding protein 1
10	9606.ENSP00000257264	0.578	Transcobalamin-1
11	9606.ENSP00000332576	0.565	Oxysterol-binding protein 2
12	9606.ENSP00000329318	0.560	Transmembrane protein 121B
13	9606.ENSP00000363891	0.549	Putative sodium-coupled neutral amino acid transporter 10
14	9606.ENSP00000483356	0.531	RIB43A domain with coiled-coils 2
15	9606.ENSP00000428612	0.522	Sodium/bile acid cotransporter 5
16	9606.ENSP00000479326	0.520	Probable component of the manchette, a microtubule-based structure which plays a key role in sperm head morphogenesis during late stages of sperm development
17	9606.ENSP00000338627	0.514	Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
18	9606.ENSP00000372390	0.514	Cationic amino acid transporter 4
19	9606.ENSP00000340610	0.507	POTE ankyrin domain family member H
20	9606.ENSP00000346959	0.505	Probable sodium-coupled neutral amino acid transporter 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901505	0.845	carbohydrate derivative transmembrane transporter activity
GO:0008514	0.460	organic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.976	localization
GO:0051234	0.971	establishment of localization
GO:0009987	0.966	cellular process
GO:0006810	0.950	transport
GO:0071702	0.944	organic substance transport
GO:0071705	0.578	nitrogen compound transport
GO:0065007	0.498	biological regulation
GO:0050789	0.374	regulation of biological process
GO:0050794	0.318	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005794	0.976	Golgi apparatus
GO:0005634	0.859	nucleus
GO:0016020	0.808	membrane
GO:0031974	0.565	membrane-enclosed lumen
GO:0070013	0.562	intracellular organelle lumen
GO:0005886	0.412	plasma membrane
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]