StarFunc result for job id Q6IE36

User Input

>input (1432 residues)
MTGSHLSHDSWQYVLLIPSVLQEGSLDKACAQLFNLTESVVLTVSLNYGEVQTKIFEENV
TGENFFKCISFEVPQARSDPLAFITFSAKGATLNLEERRSVAIRSRENVVFVQTDKPTYK
PGQKDVNGIAQFFLDTYTFTYPNITLKDPQNNRIFQWQNVTSFRNITQLSFQLISEPMFG
DYWIVVKRNSRKTVTHQFAVKRYVLPKFEVTVNAPQTVTISDDEFQVDVCAKYTFGQPVQ
GKTQIRVCREYFSSSNCEKNDNEICEQFIAQLENGCVSQIVNTKVFQLYRSGLFMTFHVA
VIVTEFGTGNYCMQISEKTSVFITQLLGTVNFENMDTFYRRGISYFGTLKFSDPNNVPMV
NKLLQLELNDEFIGNYTTDENGEAQFSIDTSDIFDPEFNLKATYVRPKSCYLPSWLTPQY
LDAHFLVSRFYSRTNSFLKIVPEPKQLECNHQKVVTVHYSLNSEAYEDDSNVKFFYLVSL
SHDSGNFQHRISSSPIYTAWNGNFSFPLSISADLAPAAVLFVYTLHPSGEIVADSVRFQV
DKCFKHKVNIKFSNEQGLPGSNASLYLQAAPVLFCALGAVDGNVLLLKSEQQLSAESVYN
MVPSIEPYGYFYHGLNLDDGKEDPCIPQRDMFYNGLYYTPVSNYGDGDIYNIVRNMGLKV
FTNLHYRKPEVCVMERRLPLPKPLYLETENYGPMHSVPSRIACRGENADYVEQAIIQTVR
TNFPETWMWDLVSVDSSGSANLSFLIPDTITQWEASGFCVNGDVGFGISSTTTLEVSQPF
FIEIASPFSVVQNEQFDLIVNAFSYLNTCVEISVQVEESQNYEANINTWKINGSEVIQAG
GRKTNIWTIIPKKLGKVNITVVAESKQSSACPNEGMEQQKLNWKDTVVKSFLVEPEGIEK
ERTQSFLICTEGAKASKQGVLDLPNDVVEGSARGFFTVVGDILGLAMQNLVVLQMPYGGG
EQNAALLASDTYVLDYLKSTEQLTEEVQSKAFFLLSNGYQRQLSFKNSDGSYSVFWQQNQ
KGSIWLSALTFKTLERMKKFVFIDENVQKQTLIWLSSQQKTSGCFKNDGQLFNHAWEGGD
EEDISLTAYVVGMFFEAGLNSTFPALRNALFCLEAALDSGVTNGYNHAILAYAFALAGKE
KQVESLLQTLDQSATKLNNVIYWERERKPKTEEFPSFIPWAPSAQTEKSCYVLLAVISRK
IPDLTYASKIVQWLAQQMNSHGGFSSNQVINVGLILIAICGEEGLFSKNQNTVTFSSEGS
SEIQFNGHNRLLVQRSEVTQAPGQYTVDVEGRGCTFIQATLKYNVLLPKKASGFSLSLEI
VKNYSLTVFDLTVNLKYTGIRNKSSMVVIDVKMLSGFTPTMSSIEELENKGQVMKTEVKN
DHVLFYLENVFGRADSFTFSVEQSNLVFNIQPAPGMVYDYYEKDGEAFLLTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q1yA	0.841	0.875	0.000	1374	0.325	0.338	7q1yA.pdb.gz
2	PDB:7vonA	0.847	0.866	0.000	1399	0.375	0.384	7vonA.pdb.gz
3	AFDB:A0A0R4IDD1	0.852	0.847	0.000	1442	0.333	0.331	A0A0R4IDD1.pdb.gz
4	AFDB:A8K2U0	0.877	0.865	0.000	1454	0.330	0.325	A8K2U0.pdb.gz	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
5	AFDB:P01023	0.917	0.892	0.000	1474	0.387	0.376	P01023.pdb.gz	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
6	AFDB:P20742	0.912	0.882	0.000	1482	0.390	0.377	P20742.pdb.gz	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
7	AFDB:P28665	0.889	0.864	0.000	1476	0.362	0.351	P28665.pdb.gz	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
8	AFDB:Q03626	0.897	0.866	0.000	1487	0.374	0.360	Q03626.pdb.gz	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
9	AFDB:Q61838	0.922	0.885	0.000	1495	0.385	0.369	Q61838.pdb.gz	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
10	AFDB:Q63041	0.915	0.875	0.000	1500	0.381	0.363	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
11	AFDB:Q6GQT1	0.918	0.893	0.000	1474	0.398	0.387	Q6GQT1.pdb.gz	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
12	AFDB:Q7SIH1	0.902	0.857	0.000	1510	0.388	0.368	Q7SIH1.pdb.gz	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
13	PDB:7q5zA	0.826	0.876	1.125E-103	1344	0.321	0.342	7q5zA.pdb.gz
14	PDB:4lnvA	0.598	0.663	5.284E-73	1276	0.192	0.216	4lnvA.pdb.gz
15	PDB:7nycA	0.422	0.397	1.216E-62	1542	0.196	0.182	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:4lnvB	0.535	0.704	2.722E-53	1063	0.175	0.235	4lnvB.pdb.gz
17	PDB:6h03A	0.421	0.484	4.981E-53	1223	0.181	0.212	6h03A.pdb.gz
18	PDB:5a42A	0.496	0.451	1.972E-49	1597	0.117	0.105	5a42A.pdb.gz
19	PDB:4ziqA	0.358	0.354	6.752E-45	1450	0.124	0.122	4ziqA.pdb.gz
20	PDB:4rtdA	0.367	0.449	1.299E-39	1122	0.115	0.146	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K2U0	0.0	760	1454	0.346	0.341	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
2	B8QSI4	0.0	770	1442	0.347	0.345	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1
3	P01023	0.0	997	1474	0.390	0.379	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
4	P06238	0.0	999	1472	0.397	0.387	A2MG_RAT Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2
5	P20742	0.0	1004	1482	0.395	0.381	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
6	P28665	0.0	903	1476	0.373	0.362	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
7	Q03626	0.0	913	1487	0.382	0.368	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
8	Q61838	0.0	943	1495	0.392	0.376	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
9	Q63041	0.0	953	1500	0.391	0.373	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
10	Q6GQT1	0.0	1003	1474	0.398	0.387	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
11	Q7SIH1	0.0	971	1510	0.393	0.373	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
12	Q6YHK3	3.86e-88	318	1445	0.185	0.183	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
13	Q8R422	1.01e-86	313	1442	0.189	0.187	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
14	Q9NFV7	8.21e-75	276	1420	0.183	0.185	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
15	Q9NFV8	2.49e-67	253	1354	0.172	0.182	Q9NFV8_DROME TEP1 protein OS=Drosophila melanogaster OX=7227 GN=Tep1 PE=2 SV=1
16	Q9NFV5	1.37e-59	228	1496	0.138	0.132	Q9NFV5_DROME TEP4 protein OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=2 SV=1
17	Q9VIT9	2.02e-59	228	1496	0.138	0.132	Q9VIT9_DROME Thioester-containing protein 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=2
18	M9PDR0	2.27e-59	228	1498	0.138	0.132	M9PDR0_DROME Thioester-containing protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
19	M9PD73	2.50e-59	227	1476	0.138	0.133	M9PD73_DROME Thioester-containing protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
20	M9PDF6	2.80e-59	227	1478	0.138	0.133	M9PDF6_DROME Thioester-containing protein 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	5.1e-21	85.6	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	1.1e-22	92.3	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	4.2e-19	80.3	A-macroglobulin receptor binding domain
4	PF01835 MG2	0.0003	32.5	MG2 domain
5	PF17791 MG3	3.7e-23	92.9	Macroglobulin domain MG3
6	PF17789 MG4	2.1e-15	68.1	Macroglobulin domain MG4
7	PF07678 TED_complement	5.9e-96	332.7	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005570141.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005543304.1	0.619	Uncharacterized protein
2	9541.XP_005578079.1	0.612	Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing
3	9541.XP_005592000.1	0.593	72 kDa type IV collagenase
4	9541.XP_005556538.1	0.587	Uncharacterized protein
5	9541.XP_005556540.1	0.587	Uncharacterized protein
6	9541.XP_005551166.1	0.564	LOW QUALITY PROTEIN: SCO-spondin
7	9541.XP_005585077.1	0.563	Envoplakin
8	9541.XP_005591854.1	0.563	195 kDa cornified envelope protein
9	9541.XP_005556852.1	0.550	Complement component C6 isoform X1
10	9541.XP_005589239.1	0.532	Uncharacterized protein
11	9541.XP_005556835.1	0.511	Complement component C9
12	9541.XP_005579788.1	0.501	Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030414	0.999	peptidase inhibitor activity
GO:0061135	0.576	endopeptidase regulator activity
GO:0004866	0.553	endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.866	developmental process
GO:0032501	0.863	multicellular organismal process
GO:0048856	0.837	anatomical structure development
GO:0007275	0.525	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.995	extracellular space
GO:0071944	0.946	cell periphery
GO:0043226	0.938	organelle
GO:0043227	0.932	membrane-bounded organelle
GO:0043230	0.886	extracellular organelle
GO:1903561	0.863	extracellular vesicle
GO:0016020	0.854	membrane
GO:0070062	0.796	extracellular exosome
GO:0005886	0.464	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]