StarFunc result for job id Q6IE37

User Input

>input (1185 residues)
MHVHVCVCLCVCIYTSSCVCACVHMCMRDALLAEGRGGGLAAADDFLYLECCKCFSQESQ
IAMVCQERSQNETYEVKMNNDTEACRATLNLEERRSVAIRSRENVVFVQTDKPTYKPGQK
DVNGIAQFFLDTYTFTYPNITLKDPQNNRIFQRQNVTSFRNITQLSFQLISEPMFGDYWI
VVKRNSRETVTHQFAVKRYVLPKFEVTVNAPQTVTISDDEFQVDVCAYNFGQPVQGETQI
RVCREYFSSSNCEKNENEICEQFIAQVQTNLDIFTLLCSSFLTVMQISEKTSVFITQLLG
TVNFENMDTFYRRGISYFGQLKFSDPNNVPMVNKLLQLELNDEFIGNYTTDENGEAQFSI
DTSDIFDPEFNLKVRHQRTEECYLPSWLTPQYLDAHFLVSRFYSRTNSFLKIVPEPKQLE
CNQQKVVTVHYSLNSEAYEDDSNVKFFYLNGNFSFPISISADLAPAAVLFVYTLHPSGEI
VADSVRFQVDKCFKHKVNIKFSNEQGLPGSNASLCLQAAPVLFCALRAVDRNVLLLKSEQ
QLSAESVSSLYNMVPSIEPYGYFYHGLNLDDGKEDPCIPQRDMFYNGLYYTPVSNYGDGD
IYNIVRVRSLRILENIIQTVRTNFPETWMWDLVSVSSSGSANLSFLIPDTITQWEASGFC
VNGDVGFGISSTTTLEVSQPFFIEIASPFSVVQNEQFDLIVNVFSYRNTCVEVSYIWECL
PGKVNITVVAESKQSSACPNEGMEQQKLNWKDTVVQSFLVEFLFLGDILGLALQNLVVLQ
MPYGSGEQNAALLASDTYVLDYLKSTEQLTEEVQSKAFFLSILGYQRQLSFKNSDGSYSV
FWQQSQKGSIWLSALTFKTLERMKKYVFIDENVQKQTLIWLSSQQKTSGCFKNDGQLFNH
ALRNALFCLEAALDSGVTNGYNHAILAYAFALAGKEKQVESLLQTLDQSAPKLSKRYYWE
RERKPKTEEFPSFIPWAPSAQTEKSCYVLLAVISRKIPDLTYASKIVQWLAQRMNSHGGF
SSNQVINVGLILIAARGEEGLFSKDQNTVTFSSEGSSEIFQVNGHNRLLVQRSEVTQAPG
EYTVDVEGHGCTFIQIFRYTGIRNKSSMVVIDVKMLSGFTPTMSSIEEVNNRSLIFQHKD
SYIEYKRADSFPFSVEQSNLVFNIQPAPAMVYDYYEKGRQATAMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6GQT1	0.807	0.660	5.168E-83	1474	0.369	0.296	Q6GQT1.pdb.gz	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
2	AFDB:P01023	0.808	0.661	4.140E-82	1474	0.369	0.296	P01023.pdb.gz	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
3	AFDB:P20742	0.805	0.655	1.842E-81	1482	0.359	0.287	P20742.pdb.gz	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
4	AFDB:Q7SIH1	0.767	0.615	2.896E-81	1510	0.354	0.278	Q7SIH1.pdb.gz	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
5	AFDB:Q63041	0.785	0.633	3.470E-81	1500	0.359	0.284	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
6	AFDB:Q61838	0.790	0.638	2.129E-79	1495	0.359	0.285	Q61838.pdb.gz	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
7	AFDB:Q03626	0.754	0.615	3.111E-75	1487	0.349	0.278	Q03626.pdb.gz	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
8	AFDB:P28665	0.728	0.597	8.846E-74	1476	0.330	0.265	P28665.pdb.gz	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
9	AFDB:A8K2U0	0.732	0.609	3.795E-71	1454	0.311	0.253	A8K2U0.pdb.gz	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
10	AFDB:A0A0R4IDD1	0.721	0.605	4.780E-70	1442	0.320	0.263	A0A0R4IDD1.pdb.gz
11	PDB:7q1yA	0.735	0.645	5.260E-69	1374	0.313	0.270	7q1yA.pdb.gz
12	PDB:7vonA	0.758	0.653	4.848E-67	1399	0.369	0.312	7vonA.pdb.gz
13	PDB:7q5zA	0.739	0.659	4.589E-59	1344	0.314	0.277	7q5zA.pdb.gz
14	PDB:4lnvA	0.496	0.465	1.029E-39	1276	0.193	0.179	4lnvA.pdb.gz
15	PDB:7nycA	0.371	0.294	1.795E-36	1542	0.200	0.154	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:6h03A	0.407	0.396	6.816E-31	1223	0.184	0.178	6h03A.pdb.gz
17	PDB:4lnvB	0.458	0.505	3.320E-30	1063	0.184	0.205	4lnvB.pdb.gz
18	PDB:5a42A	0.423	0.326	5.583E-25	1597	0.131	0.097	5a42A.pdb.gz
19	PDB:4ziqA	0.267	0.229	2.858E-23	1450	0.133	0.109	4ziqA.pdb.gz
20	PDB:4rtdA	0.261	0.272	3.799E-20	1122	0.123	0.130	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P01023	0.0	673	1474	0.380	0.305	A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3
2	P06238	0.0	672	1472	0.380	0.306	A2MG_RAT Alpha-2-macroglobulin OS=Rattus norvegicus OX=10116 GN=A2m PE=2 SV=2
3	P20742	0.0	657	1482	0.370	0.296	PZP_HUMAN Pregnancy zone protein OS=Homo sapiens OX=9606 GN=PZP PE=1 SV=4
4	P28665	0.0	574	1476	0.341	0.274	MUG1_MOUSE Murinoglobulin-1 OS=Mus musculus OX=10090 GN=Mug1 PE=1 SV=3
5	Q63041	0.0	615	1500	0.372	0.294	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
6	Q6GQT1	0.0	667	1474	0.378	0.304	A2MG_MOUSE Alpha-2-macroglobulin-P OS=Mus musculus OX=10090 GN=A2m PE=2 SV=2
7	Q61838	2.07e-179	569	1495	0.360	0.286	PZP_MOUSE Pregnancy zone protein OS=Mus musculus OX=10090 GN=Pzp PE=1 SV=3
8	B8QSI4	4.98e-156	505	1442	0.332	0.273	B8QSI4_DANRE Alpha-2 macroglobulin-like protein OS=Danio rerio OX=7955 GN=A2ML PE=1 SV=1
9	Q7SIH1	2.44e-129	434	1510	0.221	0.174	A2MG_BOVIN Alpha-2-macroglobulin OS=Bos taurus OX=9913 GN=A2M PE=1 SV=2
10	Q03626	6.91e-109	376	1487	0.211	0.168	MUG1_RAT Murinoglobulin-1 OS=Rattus norvegicus OX=10116 GN=Mug1 PE=2 SV=1
11	A8K2U0	2.03e-83	301	1454	0.182	0.149	A2ML1_HUMAN Alpha-2-macroglobulin-like protein 1 OS=Homo sapiens OX=9606 GN=A2ML1 PE=1 SV=3
12	Q6YHK3	6.59e-79	287	1445	0.256	0.210	CD109_HUMAN CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2
13	Q8R422	4.13e-59	225	1442	0.197	0.162	CD109_MOUSE CD109 antigen OS=Mus musculus OX=10090 GN=Cd109 PE=1 SV=1
14	Q9NFV7	9.25e-44	176	1420	0.124	0.104	Q9NFV7_DROME GH01829p OS=Drosophila melanogaster OX=7227 GN=Tep2 PE=1 SV=1
15	Q8IZJ3	1.12e-39	163	1885	0.140	0.088	CPMD8_HUMAN C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CPAMD8 PE=1 SV=2
16	Q9VLY7	1.01e-32	140	1469	0.172	0.139	Q9VLY7_DROME GH05679p OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=1 SV=2
17	Q9NFV6	2.48e-32	139	1469	0.140	0.113	Q9NFV6_DROME TEP3 protein OS=Drosophila melanogaster OX=7227 GN=Tep3 PE=2 SV=1
18	Q9NFV5	1.08e-30	134	1496	0.110	0.087	Q9NFV5_DROME TEP4 protein OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=2 SV=1
19	M9PDR0	1.79e-30	133	1498	0.110	0.087	M9PDR0_DROME Thioester-containing protein 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1
20	M9PD73	1.89e-30	133	1476	0.110	0.088	M9PD73_DROME Thioester-containing protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Tep4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	1.4e-22	90.6	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	2.7e-21	87.8	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	7.3e-12	57.1	A-macroglobulin receptor binding domain
4	PF12770 CHAT	94	13.9	CHAT domain
5	PF01835 MG2	0.002	29.9	MG2 domain
6	PF17791 MG3	1.5e-15	68.5	Macroglobulin domain MG3
7	PF17789 MG4	2.2e-15	68.0	Macroglobulin domain MG4
8	PF07678 TED_complement	1.7e-75	265.6	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005570141.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005543304.1	0.619	Uncharacterized protein
2	9541.XP_005578079.1	0.612	Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing
3	9541.XP_005592000.1	0.593	72 kDa type IV collagenase
4	9541.XP_005556538.1	0.587	Uncharacterized protein
5	9541.XP_005556540.1	0.587	Uncharacterized protein
6	9541.XP_005551166.1	0.564	LOW QUALITY PROTEIN: SCO-spondin
7	9541.XP_005585077.1	0.563	Envoplakin
8	9541.XP_005591854.1	0.563	195 kDa cornified envelope protein
9	9541.XP_005556852.1	0.550	Complement component C6 isoform X1
10	9541.XP_005589239.1	0.532	Uncharacterized protein
11	9541.XP_005556835.1	0.511	Complement component C9
12	9541.XP_005579788.1	0.501	Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0030414	0.963	peptidase inhibitor activity
GO:0061135	0.509	endopeptidase regulator activity
GO:0004866	0.487	endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.864	multicellular organismal process
GO:0032502	0.718	developmental process
GO:0048856	0.676	anatomical structure development
GO:0007275	0.529	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.996	extracellular space
GO:0043227	0.972	membrane-bounded organelle
GO:0071944	0.851	cell periphery
GO:1903561	0.540	extracellular vesicle
GO:0005622	0.517	intracellular anatomical structure
GO:0043229	0.434	intracellular organelle
GO:0016020	0.321	membrane
GO:0070062	0.303	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]