StarFunc result for job id Q6IE81

User Input

>input (842 residues)
MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHD
SYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSG
SEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQ
RCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKV
PEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI
TKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVK
FKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPFASLEQNREEAHRVSVRKQKL
QQLEDEFYTFVNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKR
EQDVLFRRLQLFTHLRQDLERVRNLTYMVTRREKIKRSVCKVQEQIFNLYTKLLEQERVS
GVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPL
QNSPGSEGKTLLKQPDLCGRREGMVVPESFLGLEKTFAEARLISAQQKNGVVMPDHGKRR
DNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRAATSPGVGQSAPGTRKEIVPK
CNGSLIKVNYNQTAVKVPTTPASPVKNWGGFRIPKKGERQQQGEAHDGACHQHSDYPYLG
LGRVPAKERAKSKLKSDNENDGYVPDVEMSDSESEASEKKCIHTSSTISRRTDIIRRSIL
AS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IE81	1.000	1.000	0.000	842	1.000	1.000	Q6IE81.pdb.gz	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
2	AFDB:Q803A0	0.394	0.399	1.272E-73	829	0.534	0.543	Q803A0.pdb.gz	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
3	AFDB:Q92613	0.373	0.380	2.140E-67	823	0.439	0.450	Q92613.pdb.gz	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
4	AFDB:A0A0B4KGP1	0.196	0.097	1.237E-13	1717	0.164	0.080	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
5	AFDB:A0A0C4DFL8	0.175	0.135	4.911E-5	1096	0.097	0.075	A0A0C4DFL8.pdb.gz	A0A0C4DFL8_HUMAN [histone H3]-trimethyl-L-lysine(9) demethylase OS=Homo sapiens OX=9606 GN=KDM4B PE=1 SV=1
6	AFDB:Q8VCD7	0.173	0.140	3.219E-4	1054	0.107	0.085	Q8VCD7.pdb.gz	KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus OX=10090 GN=Kdm4c PE=1 SV=1
7	AFDB:A0A0R4IEP9	0.083	0.058	7.771E-4	1332	0.105	0.066	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
8	AFDB:F1LP90	0.096	0.065	1.042E-3	1336	0.087	0.055	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
9	AFDB:O95819	0.080	0.059	6.442E-3	1239	0.107	0.073	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
10	AFDB:A0A0S2Z4R4	0.092	0.096	7.684E-3	777	0.118	0.127	A0A0S2Z4R4.pdb.gz	A0A0S2Z4R4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=2 SV=1
11	PDB:4lgwA	0.052	0.130	6.562E-1	238	0.021	0.076	4lgwA.pdb.gz
12	PDB:6dv9F	0.041	0.160	1.252	174	0.019	0.092	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
13	PDB:6qlfQ	0.070	0.222	1.781	204	0.034	0.142	6qlfQ.pdb.gz
14	PDB:6wucH	0.065	0.246	2.125	179	0.032	0.151	6wucH.pdb.gz
15	PDB:7vvuT	0.074	0.200	3.206	274	0.020	0.062	7vvuT.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
16	PDB:1copD	0.038	0.316	3.606	66	0.006	0.076	1copD.pdb.gz
17	PDB:1l3lB	0.057	0.146	3.824	233	0.015	0.056	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.
18	PDB:7abzX	0.026	0.215	3.824	77	0.006	0.065	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
19	PDB:2w1tA	0.031	0.120	4.301	175	0.007	0.034	2w1tA.pdb.gz
20	PDB:5ds9B	0.038	0.182	4.301	98	0.018	0.153	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X085	0.0	691	833	0.407	0.412	A0A087X085_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
2	A0A0C4DFT8	0.0	702	791	0.499	0.531	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
3	G3XAA4	0.0	691	834	0.407	0.411	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
4	Q6IE81	0.0	1755	842	1.000	1.000	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
5	Q6ZQF7	0.0	688	829	0.406	0.413	JADE2_MOUSE E3 ubiquitin-protein ligase Jade-2 OS=Mus musculus OX=10090 GN=Jade2 PE=1 SV=2
6	Q803A0	0.0	823	829	0.555	0.563	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
7	Q92613	0.0	672	823	0.379	0.388	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
8	Q9NQC1	0.0	705	790	0.500	0.533	JADE2_HUMAN E3 ubiquitin-protein ligase Jade-2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
9	Q7YZH1	1.73e-151	494	3241	0.293	0.076	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
10	Q7JVP4	2.81e-59	222	1430	0.164	0.097	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
11	G5E8P1	1.53e-56	213	1058	0.181	0.144	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
12	D3ZUW8	3.49e-56	212	1189	0.182	0.129	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
13	P55201	3.79e-55	209	1214	0.179	0.124	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
14	A0A5F9ZH11	5.14e-55	209	1253	0.179	0.121	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
15	O95696	1.91e-54	206	1058	0.181	0.144	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
16	Q803M2	2.60e-54	205	899	0.167	0.157	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
17	B2RRD7	5.12e-54	206	1212	0.172	0.120	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
18	Q9ULD4	4.56e-48	187	1205	0.126	0.088	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
19	Q12311	5.23e-47	182	748	0.152	0.171	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
20	O74759	3.67e-41	164	767	0.101	0.111	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	5.3	18.3	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	22	16.8	C1 domain
3	PF10513 EPL1	0.0024	29.9	Enhancer of polycomb-like
4	PF00628 PHD	3e-08	44.8	PHD-finger
5	PF13831 PHD_2	3.1e-09	47.4	PHD-finger
6	PF13771 zf-HC5HC2H	1.2e-24	97.7	PHD-like zinc-binding domain
7	PF13832 zf-HC5HC2H_2	4.7e-29	112.1	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226319

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259021	0.998	Histone acetyltransferase KAT7
2	9606.ENSP00000322142	0.990	Inhibitor of growth protein 5
3	9606.ENSP00000362166	0.977	Chromatin modification-related protein MEAF6
4	9606.ENSP00000380024	0.976	Inhibitor of growth protein 4
5	9606.ENSP00000256474	0.969	Von Hippel-Lindau disease tumor suppressor
6	9606.ENSP00000367398	0.810	Nephrocystin-4
7	9606.ENSP00000438863	0.723	Proton-activated chloride channel that mediates import of chloride ion in response to extracellular acidic pH (PubMed:31023925, PubMed:31318332). Involved in acidosis-induced cell death by mediating chloride influx and subsequent cell swelling (PubMed:31023925, PubMed:31318332)
8	9606.ENSP00000340330	0.699	Histone acetyltransferase KAT5
9	9606.ENSP00000321997	0.687	La-related protein 1B
10	9606.ENSP00000429301	0.639	Membrane-associated progesterone receptor component 2
11	9606.ENSP00000225538	0.621	P2X purinoceptor 1
12	9606.ENSP00000344456	0.621	Catenin beta-1
13	9606.ENSP00000355955	0.590	Neudesin
14	9606.ENSP00000244537	0.588	Histone cluster 1 H4 family member f
15	9606.ENSP00000376808	0.559	Cullin-5
16	9606.ENSP00000320566	0.532	Inhibitor of growth protein 3
17	9606.ENSP00000363124	0.532	PHD finger protein 20
18	9606.ENSP00000287239	0.521	Histone acetyltransferase KAT6B
19	9606.ENSP00000301391	0.514	Neuferricin
20	9606.ENSP00000315112	0.505	E3 ubiquitin-protein ligase RNF31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.999	catalytic activity, acting on a protein
GO:0005515	0.999	protein binding
GO:0016747	0.996	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0010485	0.993	histone H4 acetyltransferase activity
GO:0010484	0.944	histone H3 acetyltransferase activity
GO:0003713	0.936	transcription coactivator activity
GO:0043996	0.829	histone H4K8 acetyltransferase activity
GO:0043995	0.829	histone H4K5 acetyltransferase activity
GO:0043997	0.822	histone H4K12 acetyltransferase activity
GO:0036408	0.813	histone H3K14 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0048583	0.961	regulation of response to stimulus
GO:0043170	0.938	macromolecule metabolic process
GO:1901564	0.927	organonitrogen compound metabolic process
GO:0006275	0.925	regulation of DNA replication
GO:0048519	0.913	negative regulation of biological process
GO:0036211	0.907	protein modification process
GO:0048523	0.889	negative regulation of cellular process
GO:0009966	0.875	regulation of signal transduction
GO:0010556	0.873	regulation of macromolecule biosynthetic process
GO:0031326	0.872	regulation of cellular biosynthetic process
GO:0043967	0.831	histone H4 acetylation
GO:2001141	0.819	regulation of RNA biosynthetic process
GO:0010468	0.813	regulation of gene expression
GO:0006355	0.803	regulation of DNA-templated transcription
GO:0051726	0.763	regulation of cell cycle
GO:2000278	0.742	regulation of DNA biosynthetic process
GO:0030111	0.632	regulation of Wnt signaling pathway
GO:0009987	0.621	cellular process
GO:0051128	0.488	regulation of cellular component organization
GO:0048518	0.422	positive regulation of biological process
GO:0048522	0.379	positive regulation of cellular process
GO:0010564	0.330	regulation of cell cycle process
GO:0060828	0.311	regulation of canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0000785	0.995	chromatin
GO:1990234	0.987	transferase complex
GO:0140535	0.985	intracellular protein-containing complex
GO:0000123	0.979	histone acetyltransferase complex
GO:0005737	0.958	cytoplasm
GO:0005829	0.841	cytosol
GO:0005886	0.800	plasma membrane
GO:0005856	0.764	cytoskeleton
GO:0015630	0.736	microtubule cytoskeleton
GO:0005815	0.670	microtubule organizing center
GO:0016604	0.550	nuclear body
GO:0120025	0.527	plasma membrane bounded cell projection
GO:0005929	0.463	cilium
GO:0016607	0.406	nuclear speck
GO:0036064	0.391	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.996	Transferring groups other than amino-acyl groups.
RHEA:21992	0.993	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.993	histone acetyltransferase.

[back to server]