StarFunc result for job id Q6IEE7

User Input

>input (1074 residues)
MAPGMSGRGGAALLCLSALLAHASGRSHPASPSPPGPQASPVLPVSYRLSHTRLAFFLRE
ARPPSPAVANSSLQRSEPFVVFQTKELPVLNVSLGPFSTSQVVARELLQPSSTLDIPERL
TVNWKVRAFIVRSHVPASQPVVQVLFYVAGRDWDDFGVTERLPCVRLHAFRDAREVKSSC
RLSGGLATCLVRAELPLAWFGPPAPAAPPTARRKSPDGLEPEATGESQQAELYYTLHAPD
ASGGCGGSRRGAGPGVGARAESPTQHPLLRIGSISLFRPPPRRTLQEHRLDSNLMIRLPD
RPLKPGEVLSILLYLAPNSSSPSSPSVEHFTLRVKAKKGVTLLGTKSRSGQWHVTSELLT
GAKHSTATVDVAWAQSTPLPPREGQGPLEILQLDFEMENFTSQSVKRRIMWHIDYRGHGA
LPDLERAVTELTVIQRDVQAILPLAMDTEIINTAILTGRTVAIPVKVIAIEVNGLVLDIS
ALVECESDNEDIIKVSSSCDYVFVSGKESRGSMNARVTFRYDVLNAPLEMTVWVPKLPLH
IELSDARLSQVKGWRVPILPDRRSVRESEDEDEEEEERRQSASRGCTLQYQHATLQVFTQ
FHTTSSEGTDQVVTMLGPDWLVEVTDLVSDFMRVGDPRVAHMVDSSTLAGLEPGTTPFKV
VSPLTEAVLGETLLTVTEEKVSITQLQAQVVASLALSLRPSPGSSHTILATTAAQQTLSF
LKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSG
ELLRAELTIAESCQKTKRKSVLATTPVGLRVHFGRDEEDPTYDYPGPSQPGPGGGEDEAR
GAGPPGSALPAPEAPGPGTASPVVPPTEDFLPLPTGFLQVPRGLTDLEIGMYALLGVFCL
AILVFLINCIVFVLRYRHKRIPPEGQTSMDHSHHWVFLGNGQPLRVQGELSPPAGNPLET
VPAFCHGDHHSSGSSQTSVQSQVHGRGDGSSGGSARDQAEDPASSPTSKRKRVKFTTFTT
LPSEELAYDSVPAGEEDEEEEEDLGWGCPDVAGPTRPTAPPDLHNYMRRIKEIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:L7VG99	0.686	0.687	0.000	1073	0.577	0.578	L7VG99.pdb.gz	T132E_DANRE Transmembrane protein 132E OS=Danio rerio OX=7955 GN=tmem132e PE=2 SV=1
2	AFDB:Q6IEE6	0.788	0.788	0.000	1074	0.926	0.926	Q6IEE6.pdb.gz	T132E_MOUSE Transmembrane protein 132E OS=Mus musculus OX=10090 GN=Tmem132e PE=1 SV=2
3	AFDB:Q6PDN3	0.081	0.054	2.073E-12	1941	0.155	0.086	Q6PDN3.pdb.gz	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
4	AFDB:A0A0R4IAW3	0.117	0.133	1.144E-11	898	0.111	0.133	A0A0R4IAW3.pdb.gz
5	AFDB:Q80TE2	0.096	0.095	4.942E-11	1098	0.138	0.135	Q80TE2.pdb.gz	Q80TE2_MOUSE MKIAA1400 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
6	AFDB:P43146	0.068	0.057	5.952E-10	1447	0.120	0.089	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
7	AFDB:Q0KIB0	0.104	0.075	9.233E-10	1689	0.078	0.050	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
8	AFDB:A0A0A6YWY8	0.095	0.088	1.237E-9	1203	0.115	0.103	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
9	AFDB:O14917	0.092	0.087	1.364E-9	1159	0.100	0.092	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
10	AFDB:O95206	0.094	0.094	1.504E-9	1070	0.101	0.102	O95206.pdb.gz	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
11	PDB:4aq1A	0.097	0.128	2.034E-9	721	0.086	0.128	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:5a42A	0.093	0.070	4.228E-9	1597	0.080	0.054	5a42A.pdb.gz
13	PDB:7sqcO0	0.087	0.083	2.700E-8	1140	0.085	0.080	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:1e07A	0.106	0.157	5.346E-8	642	0.052	0.087	1e07A.pdb.gz
15	PDB:4rtdA	0.094	0.091	5.346E-8	1122	0.076	0.073	4rtdA.pdb.gz
16	PDB:4ziqA	0.098	0.080	2.096E-7	1450	0.081	0.060	4ziqA.pdb.gz
17	PDB:4lnvA	0.090	0.078	4.575E-7	1276	0.066	0.056	4lnvA.pdb.gz
18	PDB:7q1yA	0.102	0.086	7.825E-7	1374	0.078	0.061	7q1yA.pdb.gz
19	PDB:4nenA	0.125	0.126	1.214E-6	1063	0.060	0.060	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
20	PDB:5oj2B	0.086	0.117	2.289E-6	692	0.076	0.118	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	L7VG99	0.0	1150	1073	0.588	0.588	T132E_DANRE Transmembrane protein 132E OS=Danio rerio OX=7955 GN=tmem132e PE=2 SV=1
2	Q14C87	0.0	721	1099	0.410	0.400	T132D_HUMAN Transmembrane protein 132D OS=Homo sapiens OX=9606 GN=TMEM132D PE=1 SV=1
3	Q6IEE6	0.0	1843	1074	0.927	0.927	T132E_MOUSE Transmembrane protein 132E OS=Mus musculus OX=10090 GN=Tmem132e PE=1 SV=2
4	Q6IEE7	0.0	2170	1074	1.000	1.000	T132E_HUMAN Transmembrane protein 132E OS=Homo sapiens OX=9606 GN=TMEM132E PE=1 SV=2
5	Q76HP2	0.0	730	1097	0.398	0.389	T132D_RAT Transmembrane protein 132D OS=Rattus norvegicus OX=10116 GN=Tmem132d PE=2 SV=1
6	Q80WF4	1.25e-133	432	1021	0.327	0.344	T132A_RAT Transmembrane protein 132A OS=Rattus norvegicus OX=10116 GN=Tmem132a PE=1 SV=1
7	Q24JP5	2.44e-133	431	1023	0.322	0.338	T132A_HUMAN Transmembrane protein 132A OS=Homo sapiens OX=9606 GN=TMEM132A PE=1 SV=1
8	Q922P8	9.22e-114	379	1018	0.245	0.258	T132A_MOUSE Transmembrane protein 132A OS=Mus musculus OX=10090 GN=Tmem132a PE=1 SV=2
9	F4HVV6	0.013	42.4	2431	0.020	0.009	F4HVV6_ARATH Transcription regulator OS=Arabidopsis thaliana OX=3702 GN=NOT1 PE=1 SV=1
10	Q1L8D0	0.77	36.2	1125	0.035	0.034	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
11	O60478	1.2	35.4	399	0.025	0.068	G137B_HUMAN Integral membrane protein GPR137B OS=Homo sapiens OX=9606 GN=GPR137B PE=1 SV=1
12	Q8BNQ3	1.3	35.4	385	0.025	0.070	G137B_MOUSE Integral membrane protein GPR137B OS=Mus musculus OX=10090 GN=Gpr137b PE=1 SV=2
13	E6YC17	1.4	35.4	926	0.019	0.022	E6YC17_ARAHY Symbiosis receptor kinase SymRK OS=Arachis hypogaea OX=3818 PE=1 SV=2
14	P08699	1.7	34.7	262	0.023	0.095	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4
15	A2A891	6.1	33.5	1682	0.030	0.019	CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus OX=10090 GN=Camta1 PE=2 SV=1
16	P16110	7.6	32.3	264	0.022	0.091	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
17	A0A8I5ZVW8	9.0	32.7	416	0.016	0.041	A0A8I5ZVW8_RAT Cyclin-dependent kinase 8 OS=Rattus norvegicus OX=10116 GN=Cdk8 PE=3 SV=1
18	P44741	9.1	32.3	328	0.017	0.055	TEHA_HAEIN Tellurite resistance protein TehA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=tehA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04697 Pinin_SDK_N	1.1e+02	14.8	pinin/SDK conserved region
2	PF16070 TMEM132	1.6e-128	440.5	Transmembrane protein family 132
3	PF15706 TMEM132D_C	1.5e-26	103.3	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term
4	PF15705 TMEM132D_N	2e-45	165.3	Mature oligodendrocyte transmembrane protein, TMEM132D, N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000020020

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000006094	0.677	Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine
2	9555.ENSPANP00000004502	0.600	WD repeat domain 27
3	9555.ENSPANP00000010400	0.587	Oligophrenin 1
4	9555.ENSPANP00000016884	0.569	G protein-coupled receptor 137C
5	9555.ENSPANP00000017293	0.561	Transmembrane protein 211
6	9555.ENSPANP00000014763	0.553	Transmembrane protein 171
7	9555.ENSPANP00000007529	0.533	Transmembrane protein 212
8	9555.ENSPANP00000012873	0.525	annotation not available
9	9555.ENSPANP00000013933	0.519	Calcineurin-like phosphoesterase domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0030154	0.956	cell differentiation
GO:0032501	0.951	multicellular organismal process
GO:0048856	0.935	anatomical structure development
GO:0030182	0.922	neuron differentiation
GO:0048884	0.920	neuromast development
GO:0009913	0.915	epidermal cell differentiation
GO:0048916	0.915	posterior lateral line development
GO:0048919	0.909	posterior lateral line neuromast development
GO:0048886	0.907	neuromast hair cell differentiation
GO:0050896	0.561	response to stimulus
GO:0050794	0.518	regulation of cellular process
GO:0048468	0.492	cell development
GO:0048666	0.482	neuron development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.980	intracellular anatomical structure
GO:0016020	0.955	membrane
GO:0005737	0.929	cytoplasm
GO:0043226	0.921	organelle
GO:0043229	0.908	intracellular organelle
GO:0043231	0.900	intracellular membrane-bounded organelle
GO:0044297	0.866	cell body
GO:0012505	0.554	endomembrane system
GO:0036477	0.321	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]