StarFunc result for job id Q6IMN6

User Input

>input (1127 residues)
MEVQVSQASLGFELTSVEKSLREWSRLSREVIAWLCPSSPNFILNFPPPPSASSVSMVQL
FSSPFGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASPSQAYET
YIENGLICLKHKIRNIEKKKLKLEDYKDRLKSGEHLNPDQLEAVEKYEEVLHNLEFAKEL
QKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGL
NGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKH
LKDLLSKLLNSGYFESIPVPKNAKEKEVPLEEEMLIQSEKKTQLSKTESVKESESLMEFA
QPEIQPQEFLNRRYMTEVDYSNKQGEEQPWEADYARKPNLPKRWDMLTEPDGQEKKQESF
KSWEASGKHQEVSKPAVSLEQRKQDTSKLRSTLPEEQKKQEISKSKPSPSQWKQDTPKSK
AGYVQEEQKKQETPKLWPVQLQKEQDPKKQTPKSWTPSMQSEQNTTKSWTTPMCEEQDSK
QPETPKSWENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVH
QPVGSSSTLPKDPVLRKEKLQDLMTQIQGTCNFMQESVLDFDKPSSAIPTSQPPSATPGS
PVASKEQNLSSQSDFLQEPLQATSSPVTCSSNACLVTTDQASSGSETEFMTSETPEAAIP
PGKQPSSLASPNPPMAKGSEQGFQSPPASSSSVTINTAPFQAMQTVFNVNAPLPPRKEQE
IKESPYSPGYNQSFTTASTQTPPQCQLPSIHVEQTVHSQETAANYHPDGTIQVSNGSLAF
YPAQTNVFPRPTQPFVNSRGSVRGCTRGGRLITNSYRSPGGYKGFDTYRGLPSISNGNYS
QLQFQAREYSGAPYSQRDNFQQCYKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSG
DSGQGDSRSMTPVDVPVTNPAATILPVHVYPLPQQMRVAFSAARTSNLAPGTLDQPIVFD
LLLNNLGETFDLQLGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGA
PDHETASNHAILQLFQGDQIWLRLHRGAIYGSSWKYSTFSGYLLYQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IMN6	1.000	1.000	0.000	1127	1.000	1.000	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
2	AFDB:P27658	0.114	0.171	5.251E-14	744	0.122	0.185	P27658.pdb.gz	CO8A1_HUMAN Collagen alpha-1(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A1 PE=1 SV=2
3	PDB:5kc6B	0.110	0.795	1.174E-13	144	0.047	0.368	5kc6B.pdb.gz
4	PDB:5h4bA	0.108	0.823	4.591E-13	136	0.044	0.368	5h4bA.pdb.gz
5	AFDB:Q03692	0.115	0.186	2.030E-12	680	0.110	0.182	Q03692.pdb.gz	COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens OX=9606 GN=COL10A1 PE=1 SV=2
6	PDB:7e57B	0.069	0.570	1.059E-4	123	0.016	0.146	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
7	AFDB:A0A0B4KFZ2	0.081	0.080	1.121E-3	1161	0.136	0.132	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
8	PDB:3i26D	0.067	0.174	1.908E-3	369	0.014	0.043	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
9	PDB:5a3oA	0.063	0.450	2.795E-3	114	0.012	0.114	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
10	AFDB:Q9VHP9	0.049	0.042	4.630E-3	1411	0.111	0.089	Q9VHP9.pdb.gz	Q9VHP9_DROME Centromeric protein-C, isoform A OS=Drosophila melanogaster OX=7227 GN=Cenp-C PE=1 SV=4
11	PDB:1js9C	0.070	0.290	5.093E-3	189	0.020	0.116	1js9C.pdb.gz
12	PDB:5jovA	0.054	0.062	5.999E-3	949	0.012	0.015	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
13	AFDB:Q8TEP8	0.037	0.026	9.937E-3	2537	0.126	0.056	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
14	PDB:7l2zF	0.057	0.091	1.035E-2	664	0.012	0.020	7l2zF.pdb.gz
15	PDB:6oj0A	0.068	0.288	2.104E-2	178	0.009	0.056	6oj0A.pdb.gz
16	PDB:1olmE	0.056	0.134	2.222E-2	397	0.012	0.035	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
17	AFDB:Q20684	0.045	0.043	3.886E-2	1245	0.115	0.104	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
18	AFDB:Q2L6I0	0.041	0.048	5.105E-2	940	0.101	0.121	Q2L6I0.pdb.gz	Q2L6I0_HUMAN Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=2 SV=1
19	AFDB:Q9W1X4	0.048	0.037	1.520E-1	1711	0.139	0.092	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
20	AFDB:F4I1T7	0.044	0.032	1.997E-1	1819	0.133	0.082	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H142	0.0	1414	702	0.623	1.000	F5H142_HUMAN Caprin family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
2	H3BM22	0.0	1342	706	0.587	0.938	H3BM22_HUMAN Caprin family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
3	Q05A80	0.0	1688	1031	0.751	0.821	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
4	Q6IMN6	0.0	2316	1127	1.000	1.000	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
5	Q5RJ80	2.09e-116	384	914	0.240	0.296	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
6	Q60865	5.38e-58	216	707	0.102	0.163	CAPR1_MOUSE Caprin-1 OS=Mus musculus OX=10090 GN=Caprin1 PE=1 SV=2
7	Q5M9G3	1.60e-57	214	707	0.097	0.154	CAPR1_RAT Caprin-1 OS=Rattus norvegicus OX=10116 GN=Caprin1 PE=1 SV=2
8	Q14444	2.40e-56	211	709	0.099	0.158	CAPR1_HUMAN Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2
9	E7FDQ5	3.48e-56	209	670	0.096	0.161	E7FDQ5_DANRE Cell cycle-associated protein 1a OS=Danio rerio OX=7955 GN=caprin PE=1 SV=1
10	Q6DBQ6	4.25e-56	209	657	0.096	0.164	Q6DBQ6_DANRE GPI-anchored membrane protein 1 OS=Danio rerio OX=7955 GN=zgc:92043 PE=1 SV=1
11	G3V153	2.14e-47	182	628	0.088	0.158	G3V153_HUMAN Cell cycle associated protein 1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=1
12	E9PLA9	1.66e-35	135	186	0.060	0.366	E9PLA9_HUMAN Cell cycle associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=1
13	Q9I7D3	2.54e-26	119	961	0.066	0.077	CAPR1_DROME Caprin homolog OS=Drosophila melanogaster OX=7227 GN=Capr PE=1 SV=1
14	Q9BXJ4	8.27e-25	107	246	0.045	0.207	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
15	Q9ES30	1.65e-24	105	246	0.045	0.207	C1QT3_MOUSE Complement C1q tumor necrosis factor-related protein 3 OS=Mus musculus OX=10090 GN=C1qtnf3 PE=2 SV=1
16	P23435	3.04e-23	100	193	0.051	0.301	CBLN1_HUMAN Cerebellin-1 OS=Homo sapiens OX=9606 GN=CBLN1 PE=1 SV=1
17	Q9R171	5.74e-23	99.8	193	0.051	0.301	CBLN1_MOUSE Cerebellin-1 OS=Mus musculus OX=10090 GN=Cbln1 PE=1 SV=1
18	Q8BGU2	5.09e-21	95.1	224	0.047	0.237	CBLN2_MOUSE Cerebellin-2 OS=Mus musculus OX=10090 GN=Cbln2 PE=1 SV=1
19	Q9NTU7	6.14e-20	91.3	201	0.045	0.254	CBLN4_HUMAN Cerebellin-4 OS=Homo sapiens OX=9606 GN=CBLN4 PE=1 SV=1
20	Q8BME9	7.76e-20	90.9	198	0.045	0.258	CBLN4_MOUSE Cerebellin-4 OS=Mus musculus OX=10090 GN=Cbln4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	3.2e-29	113.1	C1q domain
2	PF12287 Caprin-1_C	4.2e-142	485.7	Cytoplasmic activation/proliferation-associated protein-1 C term
3	PF18293 Caprin-1_dimer	5.2e-37	138.3	Caprin-1 dimerization domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000008199

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000046673	0.627	Tudor domain containing 7
2	9598.ENSPTRP00000030809	0.517	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0097159	0.379	organic cyclic compound binding
GO:1901363	0.378	heterocyclic compound binding
GO:0003676	0.372	nucleic acid binding
GO:0003723	0.303	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0048522	0.980	positive regulation of cellular process
GO:0010604	0.961	positive regulation of macromolecule metabolic process
GO:0031325	0.924	positive regulation of cellular metabolic process
GO:0051128	0.918	regulation of cellular component organization
GO:0051174	0.910	regulation of phosphorus metabolic process
GO:0010468	0.895	regulation of gene expression
GO:0051171	0.882	regulation of nitrogen compound metabolic process
GO:0080090	0.880	regulation of primary metabolic process
GO:0048519	0.878	negative regulation of biological process
GO:0009889	0.871	regulation of biosynthetic process
GO:0019219	0.868	regulation of nucleobase-containing compound metabolic process
GO:0001932	0.854	regulation of protein phosphorylation
GO:0048523	0.853	negative regulation of cellular process
GO:0010556	0.848	regulation of macromolecule biosynthetic process
GO:0031326	0.847	regulation of cellular biosynthetic process
GO:0051252	0.834	regulation of RNA metabolic process
GO:0051173	0.823	positive regulation of nitrogen compound metabolic process
GO:0006355	0.800	regulation of DNA-templated transcription
GO:0009891	0.767	positive regulation of biosynthetic process
GO:0048583	0.764	regulation of response to stimulus
GO:0031328	0.676	positive regulation of cellular biosynthetic process
GO:0010646	0.652	regulation of cell communication
GO:0033135	0.643	regulation of peptidyl-serine phosphorylation
GO:0009966	0.633	regulation of signal transduction
GO:0065009	0.569	regulation of molecular function
GO:0051247	0.550	positive regulation of protein metabolic process
GO:0001934	0.526	positive regulation of protein phosphorylation
GO:0033138	0.516	positive regulation of peptidyl-serine phosphorylation
GO:0010557	0.444	positive regulation of macromolecule biosynthetic process
GO:0006357	0.434	regulation of transcription by RNA polymerase II
GO:0009987	0.423	cellular process
GO:0040008	0.407	regulation of growth
GO:0048584	0.407	positive regulation of response to stimulus
GO:1903508	0.357	positive regulation of nucleic acid-templated transcription
GO:0044093	0.335	positive regulation of molecular function
GO:0051098	0.308	regulation of binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0005813	0.992	centrosome
GO:0032991	0.988	protein-containing complex
GO:0005739	0.734	mitochondrion
GO:0043235	0.332	receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]