StarFunc result for job id Q6IQ16

User Input

>input (392 residues)
MSREPTPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLK
VPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDLDPEVFKEMMRFIYTGRAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMI
QSHPHLVAEAFRALASAQCPQFGIPRKRLKQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IQ16	1.000	1.000	3.861E-79	392	1.000	1.000	Q6IQ16.pdb.gz	SPOPL_HUMAN Speckle-type POZ protein-like OS=Homo sapiens OX=9606 GN=SPOPL PE=1 SV=1
2	AFDB:O43791	0.828	0.864	6.888E-67	374	0.806	0.845	O43791.pdb.gz	SPOP_HUMAN Speckle-type POZ protein OS=Homo sapiens OX=9606 GN=SPOP PE=1 SV=1
3	AFDB:Q9VFP2	0.793	0.399	1.260E-62	829	0.747	0.353	Q9VFP2.pdb.gz	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
4	AFDB:Q9SRV1	0.571	0.500	4.959E-34	465	0.301	0.254	Q9SRV1.pdb.gz	BPM4_ARATH BTB/POZ and MATH domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=BPM4 PE=1 SV=1
5	AFDB:O22286	0.480	0.463	1.610E-33	408	0.311	0.299	O22286.pdb.gz	BPM3_ARATH BTB/POZ and MATH domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=BPM3 PE=1 SV=1
6	AFDB:Q9M8J9	0.498	0.485	1.610E-33	406	0.296	0.286	Q9M8J9.pdb.gz	BPM2_ARATH BTB/POZ and MATH domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BPM2 PE=1 SV=1
7	AFDB:Q8L765	0.487	0.472	1.905E-33	407	0.293	0.283	Q8L765.pdb.gz	BPM1_ARATH BTB/POZ and MATH domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=BPM1 PE=1 SV=1
8	AFDB:A1L4W5	0.579	0.553	2.254E-33	415	0.298	0.282	A1L4W5.pdb.gz	BPM6_ARATH BTB/POZ and MATH domain-containing protein 6 OS=Arabidopsis thaliana OX=3702 GN=BPM6 PE=1 SV=1
9	AFDB:Q1EBV6	0.564	0.543	3.328E-32	410	0.304	0.290	Q1EBV6.pdb.gz	BPM5_ARATH BTB/POZ and MATH domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=BPM5 PE=1 SV=1
10	AFDB:P34371	0.476	0.458	3.520E-32	410	0.270	0.259	P34371.pdb.gz	BAT42_CAEEL BTB and MATH domain-containing protein 42 OS=Caenorhabditis elegans OX=6239 GN=bath-42 PE=1 SV=1
11	PDB:6wcqC	0.261	0.739	1.669E-7	130	0.082	0.246	6wcqC.pdb.gz
12	PDB:7mk2A	0.359	0.393	1.189E-6	354	0.087	0.096	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:4h2aA	0.148	0.092	5.353E-3	704	0.059	0.033	4h2aA.pdb.gz	Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
14	PDB:3q8fA	0.137	0.094	1.049E-2	645	0.059	0.036	3q8fA.pdb.gz	pH effects on binding between the anthrax protective antigen and the host cellular receptor CMG2.
15	PDB:7wrgB	0.179	0.104	1.313E-2	783	0.038	0.019	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
16	PDB:7wrgA	0.171	0.098	1.469E-2	812	0.048	0.023	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
17	PDB:6o6wA	0.138	0.298	1.838E-2	147	0.033	0.088	6o6wA.pdb.gz
18	PDB:6r7fQ	0.173	0.527	2.722E-2	112	0.046	0.161	6r7fQ.pdb.gz
19	PDB:5j3nA	0.113	0.114	4.264E-2	386	0.094	0.096	5j3nA.pdb.gz
20	PDB:2vqaA	0.071	0.077	4.770E-2	356	0.061	0.067	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43791	0.0	641	374	0.806	0.845	SPOP_HUMAN Speckle-type POZ protein OS=Homo sapiens OX=9606 GN=SPOP PE=1 SV=1
2	Q6IQ16	0.0	817	392	1.000	1.000	SPOPL_HUMAN Speckle-type POZ protein-like OS=Homo sapiens OX=9606 GN=SPOPL PE=1 SV=1
3	Q6ZWS8	0.0	641	374	0.806	0.845	SPOP_MOUSE Speckle-type POZ protein OS=Mus musculus OX=10090 GN=Spop PE=1 SV=1
4	Q9VFP2	0.0	587	829	0.750	0.355	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
5	O22286	4.18e-49	172	408	0.309	0.297	BPM3_ARATH BTB/POZ and MATH domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=BPM3 PE=1 SV=1
6	Q94420	1.00e-48	171	395	0.278	0.276	MEL26_CAEEL Protein maternal effect lethal 26 OS=Caenorhabditis elegans OX=6239 GN=mel-26 PE=1 SV=2
7	K8F7T2	1.20e-48	171	399	0.281	0.276	K8F7T2_CAEEL Protein roadkill OS=Caenorhabditis elegans OX=6239 GN=mel-26 PE=1 SV=1
8	Q9SRV1	1.89e-45	164	465	0.291	0.245	BPM4_ARATH BTB/POZ and MATH domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=BPM4 PE=1 SV=1
9	Q8L765	1.58e-44	160	407	0.286	0.275	BPM1_ARATH BTB/POZ and MATH domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=BPM1 PE=1 SV=1
10	Q9M8J9	1.49e-43	158	406	0.296	0.286	BPM2_ARATH BTB/POZ and MATH domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BPM2 PE=1 SV=1
11	A1L4W5	9.88e-40	148	415	0.270	0.255	BPM6_ARATH BTB/POZ and MATH domain-containing protein 6 OS=Arabidopsis thaliana OX=3702 GN=BPM6 PE=1 SV=1
12	Q1EBV6	1.16e-36	139	410	0.273	0.261	BPM5_ARATH BTB/POZ and MATH domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=BPM5 PE=1 SV=1
13	P34371	6.90e-29	118	410	0.247	0.237	BAT42_CAEEL BTB and MATH domain-containing protein 42 OS=Caenorhabditis elegans OX=6239 GN=bath-42 PE=1 SV=1
14	Q9NF14	9.32e-20	92.4	402	0.209	0.204	BAT40_CAEEL BTB and MATH domain-containing protein 40 OS=Caenorhabditis elegans OX=6239 GN=bath-40 PE=1 SV=1
15	B9DHT4	1.28e-19	93.2	710	0.125	0.069	ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
16	P41886	1.62e-19	91.7	418	0.222	0.208	BAT41_CAEEL BTB and MATH domain-containing protein 41 OS=Caenorhabditis elegans OX=6239 GN=bath-41 PE=1 SV=1
17	B7U179	4.22e-19	91.7	737	0.125	0.066	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
18	Q6DBN1	3.30e-17	82.4	243	0.135	0.218	Y4845_ARATH BTB/POZ domain-containing protein At4g08455 OS=Arabidopsis thaliana OX=3702 GN=At4g08455 PE=1 SV=1
19	B3DIV9	2.50e-16	82.8	612	0.115	0.074	KL40A_DANRE Kelch-like protein 40a OS=Danio rerio OX=7955 GN=klhl40a PE=2 SV=2
20	Q8IXQ5	4.31e-16	82.0	586	0.120	0.080	KLHL7_HUMAN Kelch-like protein 7 OS=Homo sapiens OX=9606 GN=KLHL7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.4e-29	113.9	BTB/POZ domain
2	PF00917 MATH	0.0053	28.3	MATH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000016754

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011891	0.996	Cullin 3
2	61853.ENSNLEP00000003817	0.980	Speckle-type POZ protein
3	61853.ENSNLEP00000001150	0.965	GLI family zinc finger 2
4	61853.ENSNLEP00000021050	0.961	GLI family zinc finger 1
5	61853.ENSNLEP00000009181	0.945	Kelch repeat and BTB (POZ) domain containing 8
6	61853.ENSNLEP00000018730	0.927	Ring-box 1, E3 ubiquitin protein ligase
7	61853.ENSNLEP00000021992	0.923	Kelch-like family member 12
8	61853.ENSNLEP00000010500	0.920	Kelch-like family member 21
9	61853.ENSNLEP00000017918	0.919	Kelch-like family member 7
10	61853.ENSNLEP00000009641	0.898	Kelch-like family member 22
11	61853.ENSNLEP00000018430	0.883	SUFU negative regulator of hedgehog signaling
12	61853.ENSNLEP00000011537	0.882	Kelch-like family member 8
13	61853.ENSNLEP00000018569	0.882	Kelch-like family member 20
14	61853.ENSNLEP00000010376	0.881	Kelch-like family member 3
15	61853.ENSNLEP00000006744	0.880	Kelch-like family member 42
16	61853.ENSNLEP00000014865	0.877	Kelch-like ECH-associated protein 1
17	61853.ENSNLEP00000012947	0.876	Gigaxonin
18	61853.ENSNLEP00000017937	0.876	Kelch-like family member 13
19	61853.ENSNLEP00000005839	0.874	Ectodermal-neural cortex 1 (with BTB domain)
20	61853.ENSNLEP00000005892	0.874	Kelch-like family member 41

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.779	enzyme binding
GO:0042802	0.462	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.990	cellular process
GO:0019538	0.990	protein metabolic process
GO:0009056	0.983	catabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0048519	0.951	negative regulation of biological process
GO:0006511	0.939	ubiquitin-dependent protein catabolic process
GO:0043161	0.865	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0009892	0.807	negative regulation of metabolic process
GO:0051172	0.788	negative regulation of nitrogen compound metabolic process
GO:0010605	0.776	negative regulation of macromolecule metabolic process
GO:1903320	0.773	regulation of protein modification by small protein conjugation or removal
GO:0050794	0.705	regulation of cellular process
GO:0031400	0.489	negative regulation of protein modification process
GO:0031396	0.450	regulation of protein ubiquitination
GO:0016567	0.411	protein ubiquitination
GO:0050896	0.403	response to stimulus
GO:1903321	0.398	negative regulation of protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.997	cellular anatomical entity
GO:0031461	0.997	cullin-RING ubiquitin ligase complex
GO:0031463	0.991	Cul3-RING ubiquitin ligase complex
GO:0031981	0.990	nuclear lumen
GO:0005654	0.976	nucleoplasm
GO:0005829	0.939	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]