StarFunc result for job id Q6IQ19

User Input

>input (270 residues)
MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSED
SASSESSGAGGPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAA
LPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKEN
KHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHS
VDVEKNRKMKASSSENPWMTEYMRCYSARA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IQ19	0.999	0.999	7.361E-38	270	1.000	1.000	Q6IQ19.pdb.gz	CCSAP_HUMAN Centriole, cilia and spindle-associated protein OS=Homo sapiens OX=9606 GN=CCSAP PE=1 SV=2
2	AFDB:Q6P3G4	0.209	0.214	1.841E-14	263	0.426	0.437	Q6P3G4.pdb.gz	CCSAP_DANRE Centriole, cilia and spindle-associated protein OS=Danio rerio OX=7955 GN=ccsap PE=2 SV=2
3	AFDB:A2AUM9	0.129	0.027	1.171	1736	0.133	0.021	A2AUM9.pdb.gz	CE152_MOUSE Centrosomal protein of 152 kDa OS=Mus musculus OX=10090 GN=Cep152 PE=1 SV=1
4	AFDB:P38236	0.154	0.122	1.171	366	0.126	0.093	P38236.pdb.gz	FL2D_YEAST Protein MUM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MUM2 PE=1 SV=1
5	AFDB:Q385X7	0.145	0.066	1.643	646	0.163	0.068	Q385X7.pdb.gz	Q385X7_TRYB2 TATA element modulatory factor 1 TATA binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1950 PE=4 SV=1
6	AFDB:Q96NB3	0.160	0.126	1.882	372	0.167	0.121	Q96NB3.pdb.gz	ZN830_HUMAN Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2
7	PDB:7mqaNA	0.128	0.120	2.204	295	0.030	0.027	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	AFDB:F1R1E6	0.110	0.067	3.024	480	0.141	0.079	F1R1E6.pdb.gz
9	AFDB:P25579	0.106	0.057	3.024	583	0.104	0.048	P25579.pdb.gz	LRE1_YEAST Laminarase-resistance protein LRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LRE1 PE=1 SV=2
10	AFDB:Q9VHG3	0.130	0.131	3.236	268	0.163	0.164	Q9VHG3.pdb.gz	Q9VHG3_DROME IP14615p OS=Drosophila melanogaster OX=7227 GN=sage PE=2 SV=1
11	AFDB:M9PJ28	0.162	0.053	3.706	987	0.167	0.046	M9PJ28.pdb.gz	M9PJ28_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Alms1b PE=4 SV=1
12	PDB:7oyaL1	0.102	0.131	9.788	197	0.022	0.030	7oyaL1.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IQ19	0.0	550	270	1.000	1.000	CCSAP_HUMAN Centriole, cilia and spindle-associated protein OS=Homo sapiens OX=9606 GN=CCSAP PE=1 SV=2
2	Q6P3G4	8.99e-56	182	263	0.444	0.456	CCSAP_DANRE Centriole, cilia and spindle-associated protein OS=Danio rerio OX=7955 GN=ccsap PE=2 SV=2
3	Q704Y3	1.4	32.7	839	0.107	0.035	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1
4	Q8I3E5	5.0	31.2	2270	0.130	0.015	Q8I3E5_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0900100 PE=4 SV=1
5	Q9L7Q2	6.6	30.8	1906	0.115	0.016	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
6	Q9JJV9	6.8	30.8	2019	0.074	0.010	SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus OX=10090 GN=Scn5a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15748 CCSAP	3.9e-97	336.9	Centriole, cilia and spindle-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284617

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302537	0.693	Nuclear protein MDM1
2	9606.ENSP00000233336	0.681	Tubulin--tyrosine ligase
3	9606.ENSP00000276603	0.661	Telomeric repeat-binding factor 1
4	9606.ENSP00000260505	0.659	Tubulin polyglutamylase TTLL7
5	9606.ENSP00000323304	0.631	Leucine rich single-pass membrane protein 1
6	9606.ENSP00000363999	0.602	Mitochondrial ribosomal protein L50
7	9606.ENSP00000239587	0.600	Probable tubulin polyglutamylase TTLL2
8	9606.ENSP00000418086	0.584	Uncharacterized protein C3orf14
9	9606.ENSP00000359434	0.558	Protein CXorf40B
10	9606.ENSP00000257287	0.538	Centrosomal protein of 135 kDa
11	9606.ENSP00000303058	0.530	Centrosomal protein of 120 kDa
12	9606.ENSP00000335384	0.510	Zona pellucida-binding protein 2
13	9606.ENSP00000216129	0.501	Tubulin--tyrosine ligase-like protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0044087	0.982	regulation of cellular component biogenesis
GO:0033043	0.975	regulation of organelle organization
GO:0097435	0.974	supramolecular fiber organization
GO:1902115	0.968	regulation of organelle assembly
GO:0032984	0.966	protein-containing complex disassembly
GO:0000226	0.965	microtubule cytoskeleton organization
GO:0031109	0.963	microtubule polymerization or depolymerization
GO:0051261	0.953	protein depolymerization
GO:0060236	0.952	regulation of mitotic spindle organization
GO:0007019	0.918	microtubule depolymerization
GO:0008152	0.392	metabolic process
GO:0071704	0.354	organic substance metabolic process
GO:0048523	0.330	negative regulation of cellular process
GO:0044238	0.300	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005814	0.999	centriole
GO:0005813	0.999	centrosome
GO:0036064	0.998	ciliary basal body
GO:0043005	0.992	neuron projection
GO:0005930	0.991	axoneme
GO:0035869	0.989	ciliary transition zone
GO:0000235	0.989	astral microtubule
GO:0030424	0.980	axon
GO:0072686	0.972	mitotic spindle
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0061673	0.697	mitotic spindle astral microtubule
GO:0005829	0.348	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]