StarFunc result for job id Q6IQ23

User Input

>input (1121 residues)
MAAATVGRDTLPEHWSYGVCRDGRVFFINDQLRCTTWLHPRTGEPVNSGHMIRSDLPRGW
EEGFTEEGASYFIDHNQQTTAFRHPVTGQFSPENSEFILQEEPNPHMSKQDRNQRPSSMV
SETSTAGTASTLEAKPGPKIIKSSSKVHSFGKRDQAIRRNPNVPVVVRGWLHKQDSSGMR
LWKRRWFVLADYCLFYYKDSREEAVLGSIPLPSYVISPVAPEDRISRKYSFKAVHTGMRA
LIYNSSTAGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSRSSLKRDMEKVERQA
VPQANHTESCHECGRVGPGHTRDCPHRGHDDIVNFERQEQEGEQYRSQRDPLEGKRDRSK
ARSPYSPAEEDALFMDLPTGPRGQQAQPQRAEKNGMLPASYGPGEQNGTGGYQRAFPPRT
NPEKHSQRKSNLAQVEHWARAQKGDSRSLPLDQTLPRQGPGQSLSFPENYQTLPKSTRHP
SGGSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAP
ICLGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPPPGPPRVFPPRRPHTPAERVTVKPPD
QRRSVDISLGDSPRRARGHAVKNSSHVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQLK
KDLEYLDLKMTGRDLLKDRSLKPVKIAESDTDVKLSIFCEQDRVLQDLEDKIRALKENKD
QLESVLEVLHRQMEQYRDQPQHLEKIAYQQKLLQEDLVHIRAELSRESTEMENAWNEYLK
LENDVEQLKQTLQEQHRRAFFFQEKSQIQKDLWRIEDVTAGLSANKENFRILVESVKNPE
RKTVPLFPHPPVPSLSTSESKPPPQPSPPTSPVRTPLEVRLFPQLQTYVPYRPHPPQLRK
VTSPLQSPTKAKPKVEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKRQS
DERKRDRELGQCVNGDSRVELRSYVSEPELATLSGDMAQPSLGLVGPESRYQTLPGRGLS
GSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKSALERLYSGDHQRGKMSAEEQLERM
KRHQKALVRERKRTLGQGERTGLPSSRYLSRPLPGDLGSVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PKC0	0.215	0.195	0.000	1271	0.998	0.880	E9PKC0.pdb.gz	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
2	AFDB:B6RSP1	0.174	0.164	1.841E-83	1197	0.533	0.499	B6RSP1.pdb.gz	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
3	AFDB:Q9HAU0	0.145	0.145	7.999E-44	1116	0.294	0.296	Q9HAU0.pdb.gz	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
4	AFDB:A0A024RAY7	0.142	0.138	1.459E-43	1174	0.296	0.283	A0A024RAY7.pdb.gz
5	AFDB:F6NTT0	0.089	0.134	2.187E-8	712	0.133	0.209	F6NTT0.pdb.gz	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
6	AFDB:Q9UQC2	0.090	0.145	1.190E-7	676	0.128	0.212	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
7	AFDB:D3ZAL7	0.091	0.142	8.513E-7	693	0.128	0.206	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
8	AFDB:Q9QYY0	0.089	0.139	9.496E-7	695	0.120	0.194	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
9	AFDB:P49797	0.112	0.126	1.318E-6	967	0.085	0.098	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
10	PDB:6bbpA	0.080	0.164	1.620E-6	520	0.029	0.063	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
11	PDB:3ljuX	0.084	0.245	3.884E-6	373	0.020	0.059	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	PDB:6u3eA	0.083	0.225	5.391E-6	397	0.025	0.071	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
13	PDB:4mt6A	0.093	0.246	3.099E-5	389	0.018	0.051	4mt6A.pdb.gz
14	PDB:6hhgA	0.085	0.237	4.798E-5	386	0.021	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	PDB:6s9wA	0.083	0.219	5.653E-5	411	0.021	0.056	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
16	AFDB:O60293	0.036	0.023	7.123E-5	1989	0.114	0.064	O60293.pdb.gz	ZC3H1_HUMAN Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3
17	PDB:7rx9A	0.084	0.207	1.687E-4	432	0.027	0.069	7rx9A.pdb.gz
18	PDB:4mk0A	0.088	0.151	3.432E-4	631	0.015	0.027	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3uzsA	0.084	0.149	1.274E-3	609	0.014	0.026	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:4iapA	0.062	0.258	1.346E-3	256	0.017	0.074	4iapA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6Z8	0.0	1763	1159	0.813	0.786	A0A0G2K6Z8_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=2
2	A0A1B0GTN9	0.0	1824	1192	0.847	0.797	A0A1B0GTN9_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
3	A0A1B0GUN0	0.0	986	527	0.445	0.947	A0A1B0GUN0_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
4	A0A8I5ZXL6	0.0	1980	1116	0.900	0.904	A0A8I5ZXL6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
5	A0A8I6A1V7	0.0	1977	1274	0.898	0.790	A0A8I6A1V7_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
6	A0A8I6A229	0.0	1826	1054	0.838	0.891	A0A8I6A229_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
7	A0A8I6A7D6	0.0	1818	1218	0.836	0.769	A0A8I6A7D6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
8	A0A8I6GKY3	0.0	1980	1264	0.898	0.797	A0A8I6GKY3_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1
9	B6RSP1	0.0	1002	1197	0.546	0.511	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
10	D3ZRT6	0.0	1767	1190	0.819	0.771	D3ZRT6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=3
11	E9PKC0	0.0	2303	1271	0.998	0.880	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
12	H0YDE2	0.0	1516	753	0.670	0.997	H0YDE2_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
13	Q3UIL6	0.0	2006	1118	0.900	0.903	PKHA7_MOUSE Pleckstrin homology domain-containing family A member 7 OS=Mus musculus OX=10090 GN=Plekha7 PE=1 SV=2
14	Q6IQ23	0.0	2302	1121	1.000	1.000	PKHA7_HUMAN Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2
15	A0A0N4SWD7	2.72e-139	448	1000	0.273	0.306	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
16	Q9HAU0	1.92e-135	441	1116	0.274	0.275	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
17	E9Q6H8	1.62e-125	417	1269	0.275	0.243	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
18	A0A0N4SUU0	2.42e-108	363	956	0.237	0.278	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
19	Q6ZPK1	5.15e-100	345	1205	0.246	0.229	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
20	E9PL74	5.74e-100	314	152	0.136	1.000	E9PL74_HUMAN Pleckstrin homology domain containing A7 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=8

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07798 CCDC90-like	3.9e+02	12.4	Coiled-coil domain-containing protein 90-like
2	PF10498 IFT57	2.3e+02	12.1	Intra-flagellar transport protein 57
3	PF12631 MnmE_helical	1.1e+02	14.4	MnmE helical domain
4	PF07934 OGG_N	1.9e+02	13.6	8-oxoguanine DNA glycosylase, N-terminal domain
5	PF00169 PH	8.3e-16	69.8	PH domain
6	PF15413 PH_11	5.1e-06	38.3	Pleckstrin homology domain
7	PF20399 PH_20	1.2e+02	14.2	PH domain
8	PF14593 PH_3	2	19.9	PH domain
9	PF15409 PH_8	0.0075	27.8	Pleckstrin homology domain
10	PF00397 WW	1.4e-06	39.6	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347883

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382004	0.999	Catenin delta-1
2	9606.ENSP00000416797	0.998	Calmodulin-regulated spectrin-associated protein 3
3	9606.ENSP00000261769	0.983	Cadherin-1
4	9606.ENSP00000304669	0.961	Catenin alpha-1
5	9606.ENSP00000344456	0.948	Catenin beta-1
6	9606.ENSP00000239666	0.940	Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33
7	9606.ENSP00000483872	0.940	Tetraspanin-33
8	9606.ENSP00000375960	0.927	Afadin
9	9606.ENSP00000368976	0.922	Kinesin-like protein KIFC3
10	9606.ENSP00000260408	0.807	Disintegrin and metalloproteinase domain-containing protein 10
11	9606.ENSP00000281537	0.785	Tight junction protein ZO-1
12	9606.ENSP00000281282	0.765	Cingulin-like protein 1
13	9606.ENSP00000353739	0.762	protein-L-isoaspartate O-methyltransferase domain containing 1
14	9606.ENSP00000425979	0.734	Ribonuclease 3
15	9606.ENSP00000225174	0.730	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
16	9606.ENSP00000265333	0.726	Voltage-dependent anion-selective channel protein 1
17	9606.ENSP00000268704	0.726	Paraplegin
18	9606.ENSP00000293288	0.724	Apoptosis regulator BAX
19	9606.ENSP00000363591	0.724	Bcl-2 homologous antagonist/killer
20	9606.ENSP00000381185	0.724	Apoptosis regulator Bcl-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0065008	0.953	regulation of biological quality
GO:0003018	0.925	vascular process in circulatory system
GO:0009987	0.922	cellular process
GO:0008015	0.905	blood circulation
GO:0097746	0.859	blood vessel diameter maintenance
GO:0042311	0.822	vasodilation
GO:0071840	0.682	cellular component organization or biogenesis
GO:0016043	0.625	cellular component organization
GO:0050789	0.461	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.995	membrane
GO:0032991	0.993	protein-containing complex
GO:0098796	0.876	membrane protein complex
GO:0070161	0.875	anchoring junction
GO:0046930	0.619	pore complex
GO:0005911	0.481	cell-cell junction
GO:0071944	0.477	cell periphery
GO:0005886	0.448	plasma membrane
GO:0031982	0.375	vesicle
GO:0005576	0.374	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]