StarFunc result for job id Q6IQ26

User Input

>input (1287 residues)
MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTE
GENFEQTPLRRTFKSKVLARYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAF
IITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHMHNAEYDVLHAPPADDRDQSSMEDG
EDTPVTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLEQLHQAVTSPQPPPLPL
ESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQ
LFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYL
MGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGI
PPEGNLHCSESASKLKRLRASELVSDKRNGNIAGSPLHSYELLKENETIARLQALVKRTG
VSLEKLEVREDPSSNKDLKVQCDEEELRIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ
DKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPV
LRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAIHPHLLDMKI
GQGKYEPGFFPKLQSDVLSTGPASNKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYI
QEARTMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHG
EVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQDNRQRKLTSGSLSTS
GILLDSERRKSDASSLMPPLRISLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRH
LKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILI
VPSKKLGGSMFTANPWICISGELGETQIMQIPRNVLEMTFECQNLGKLTTVQIGHDNSGL
YAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERILVGELLTSQPEVDERPCRTP
PLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSLTLLLCGE
CGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTYYETLEKNEVVPEENWHTRARNFCR
FVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLV
NSLIRVLQTLQEFNITLETSLVKGIDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RSQ0	0.495	0.500	0.000	1274	0.711	0.718	A2RSQ0.pdb.gz	DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus OX=10090 GN=Dennd5b PE=1 SV=2
2	AFDB:G3V7Q0	0.512	0.512	0.000	1287	0.975	0.975	G3V7Q0.pdb.gz	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
3	AFDB:Q8RXA7	0.283	0.305	4.318E-24	1187	0.146	0.158	Q8RXA7.pdb.gz	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
4	AFDB:Q5VZ89	0.330	0.229	1.313E-23	1909	0.119	0.080	Q5VZ89.pdb.gz	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
5	AFDB:Q9VGH9	0.310	0.209	1.640E-23	1993	0.166	0.107	Q9VGH9.pdb.gz	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
6	AFDB:Q86WG5	0.283	0.204	3.652E-23	1849	0.138	0.096	Q86WG5.pdb.gz	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
7	AFDB:A6H8H2	0.309	0.215	6.808E-23	1906	0.122	0.082	A6H8H2.pdb.gz	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
8	AFDB:Q7Z401	0.333	0.235	1.811E-22	1863	0.107	0.074	Q7Z401.pdb.gz	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
9	AFDB:O95248	0.295	0.209	2.826E-22	1868	0.138	0.095	O95248.pdb.gz	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
10	AFDB:E9PXF8	0.279	0.199	3.229E-22	1872	0.136	0.093	E9PXF8.pdb.gz	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
11	PDB:7ttjA	0.073	0.141	2.553E-5	643	0.016	0.031	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
12	PDB:3v99B	0.072	0.141	3.810E-5	639	0.016	0.033	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
13	PDB:7ttlC	0.073	0.148	4.354E-5	617	0.015	0.031	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
14	PDB:1ca1A	0.086	0.225	5.686E-5	370	0.025	0.086	1ca1A.pdb.gz	Structure of the key toxin in gas gangrene.
15	PDB:2p0mA	0.072	0.135	8.117E-5	662	0.018	0.035	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
16	PDB:7ttjB	0.071	0.147	8.486E-5	590	0.015	0.032	7ttjB.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
17	PDB:6ncfB	0.073	0.134	1.976E-4	676	0.015	0.028	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
18	PDB:6oauA	0.080	0.227	2.697E-4	422	0.013	0.040	6oauA.pdb.gz	Structure of lipoprotein lipase in complex with GPIHBP1.
19	PDB:1lpaB	0.072	0.196	4.025E-4	449	0.012	0.036	1lpaB.pdb.gz	Interfacial activation of the lipase-procolipase complex by mixed micelles revealed by X-ray crystallography.
20	PDB:4nreA	0.073	0.136	5.028E-4	675	0.014	0.027	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RSQ0	0.0	1900	1274	0.715	0.722	DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus OX=10090 GN=Dennd5b PE=1 SV=2
2	G3V7Q0	0.0	2632	1287	0.976	0.976	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
3	Q6IQ26	0.0	2685	1287	1.000	1.000	DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A PE=1 SV=2
4	Q6PAL8	0.0	2633	1287	0.977	0.977	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1
5	Q6ZUT9	0.0	1905	1274	0.715	0.722	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2
6	Q5VZ89	9.66e-30	131	1909	0.076	0.051	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
7	Q8RXA7	2.18e-28	126	1187	0.067	0.072	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
8	Q9W3D3	5.89e-27	122	1671	0.086	0.066	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
9	Q7KSP6	1.33e-26	121	1973	0.084	0.055	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
10	Q9VGH9	1.86e-26	120	1993	0.084	0.054	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
11	Q7Z401	1.12e-25	118	1863	0.068	0.047	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
12	A6H8H2	1.16e-23	111	1906	0.073	0.049	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
13	M0RAP5	1.91e-22	107	1893	0.068	0.046	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
14	E9PXF8	1.98e-22	107	1872	0.077	0.053	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
15	Q6ZPE2	2.62e-22	107	1867	0.069	0.048	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
16	Q86WG5	3.44e-21	103	1849	0.075	0.052	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
17	A0A8I6AD51	5.15e-21	102	1875	0.069	0.047	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
18	O95248	4.29e-20	99.8	1868	0.068	0.047	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
19	O75064	6.60e-20	99.4	1496	0.065	0.056	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
20	O02626	5.17e-19	96.3	1409	0.070	0.064	MADD_CAEEL MAP kinase-activating death domain protein OS=Caenorhabditis elegans OX=6239 GN=aex-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	7.4e-14	62.9	dDENN domain
2	PF02141 DENN	7.2e-58	207.1	DENN (AEX-3) domain
3	PF01477 PLAT	2.3e-11	55.7	PLAT/LH2 domain
4	PF02759 RUN	1.9e-26	104.2	RUN domain
5	PF03456 uDENN	1.2e-11	56.2	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311449	0.990	Ras-related protein Rab-6A
2	9606.ENSP00000358466	0.951	Ras-related protein Rab-39B
3	9606.ENSP00000322594	0.919	Ras-related protein Rab-39A
4	9606.ENSP00000355511	0.910	Rab proteins geranylgeranyltransferase component A 2
5	9606.ENSP00000350386	0.909	Rab proteins geranylgeranyltransferase component A 1
6	9606.ENSP00000394071	0.903	Rab GDP dissociation inhibitor alpha
7	9606.ENSP00000261890	0.902	Ras-related protein Rab-11A
8	9606.ENSP00000369538	0.902	Rab GDP dissociation inhibitor beta
9	9606.ENSP00000261889	0.897	Sorting nexin-1
10	9606.ENSP00000307939	0.689	GRIP and coiled-coil domain-containing protein 2
11	9606.ENSP00000473565	0.683	DENN domain-containing protein 4C
12	9606.ENSP00000387307	0.676	Ras-related protein Rab-6C
13	9606.ENSP00000310933	0.666	MAP kinase-activating death domain protein
14	9606.ENSP00000262585	0.653	DENN domain-containing protein 3
15	9606.ENSP00000373734	0.603	DENN domain-containing protein 5B
16	9606.ENSP00000315568	0.583	Late secretory pathway protein AVL9 homolog
17	9606.ENSP00000433528	0.558	Suppression of tumorigenicity 5 protein
18	9606.ENSP00000262726	0.536	EF-hand calcium-binding domain-containing protein 6
19	9606.ENSP00000276066	0.523	Ras-related protein Rab-41
20	9606.ENSP00000285208	0.523	Ras-related protein Rab-6B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0051020	0.688	GTPase binding
GO:0031267	0.684	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.968	cellular process
GO:0050794	0.956	regulation of cellular process
GO:0051179	0.891	localization
GO:0051234	0.865	establishment of localization
GO:0006810	0.859	transport
GO:0046907	0.725	intracellular transport
GO:0016192	0.663	vesicle-mediated transport
GO:0016482	0.648	cytosolic transport
GO:0016197	0.600	endosomal transport
GO:0051128	0.566	regulation of cellular component organization
GO:0048519	0.485	negative regulation of biological process
GO:0042147	0.422	retrograde transport, endosome to Golgi

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005794	0.985	Golgi apparatus
GO:0005829	0.935	cytosol
GO:0031982	0.883	vesicle
GO:0016020	0.865	membrane
GO:0032991	0.366	protein-containing complex
GO:0098791	0.334	Golgi apparatus subcompartment
GO:0005802	0.306	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]