StarFunc result for job id Q6IQ32

User Input

>input (1131 residues)
MFQIPVENLDNIRKVRKKVKGILVDIGLDSCKELLKDLKGFDPGEKYFHNTSWGDVSLWE
PSGKKVRYRTKPYCCGLCKYSTKVLTSFKNHLHRYHEDEIDQELVIPCPNCVFASQPKVV
GRHFRMFHAPVRKVQNYTVNILGETKSSRSDVISFTCLKCNFSNTLYYSMKKHVLVAHFH
YLINSYFGLRTEEMGEQPKTNDTVSIEKIPPPDKYYCKKCNANASSQDALMYHILTSDIH
RDLENKLRSVISEHIKRTGLLKQTHIAPKPAAHLAAPANGSAPSAPAQPPCFHLALPQNS
PSPAAGQPVTVAQGAPGSLTHSPPAAGQSHMTLVSSPLPVGQNSLTLQPPAPQPVFLSHG
VPLHQSVNPPVLPLSQPVGPVNKSVGTSVLPINQTVRPGVLPLTQPVGPINRPVGPGVLP
VSPSVTPGVLQAVSPGVLSVSRAVPSGVLPAGQMTPAGQMTPAGVIPGQTATSGVLPTGQ
MVQSGVLPVGQTAPSRVLPPGQTAPLRVISAGQVVPSGLLSPNQTVSSSAVVPVNQGVNS
GVLQLSQPVVSGVLPVGQPVRPGVLQLNQTVGTNILPVNQPVRPGASQNTTFLTSGSILR
QLIPTGKQVNGIPTYTLAPVSVTLPVPPGGLATVAPPQMPIQLLPSGAAAPMAGSMPGMP
SPPVLVNAAQSVFVQASSSAADTNQVLKQAKQWKTCPVCNELFPSNVYQVHMEVAHKHSE
SKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFH
DIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGEREVY
LAILAGIHSKSLVPVYVKVRPQAEGTPGSTGKRVSTCPFCFGPFVTTEAYELHLKERHHI
MPTVHTVLKSPAFKCIHCCGVYTGNMTLAAIAVHLVRCRSAPKDSSSDLQAQPGFIHNSE
LLLVSGEVMHDSSFSVKRKLPDGHLGAEDQRHGEEQPPILNADAAPGPEKVTSVVPFKRQ
RNESRTEGPIVKDEALQILALDPKKYEGRSYEEKKQFLKDYFHKKPYPSKKEIELLSSLF
WVWKIDVASFFGKRRYICMKAIKNHKPSVLLGFDMSELKNVKHRLNFEYEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IQ32	1.000	1.000	0.000	1131	1.000	1.000	Q6IQ32.pdb.gz	ADNP2_HUMAN Activity-dependent neuroprotector homeobox protein 2 OS=Homo sapiens OX=9606 GN=ADNP2 PE=1 SV=1
2	AFDB:Q8CHC8	0.290	0.283	0.000	1165	0.798	0.775	Q8CHC8.pdb.gz	ADNP2_MOUSE Activity-dependent neuroprotector homeobox protein 2 OS=Mus musculus OX=10090 GN=Adnp2 PE=1 SV=2
3	AFDB:P14404	0.051	0.048	2.087E-7	1232	0.140	0.128	P14404.pdb.gz	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
4	AFDB:Q9HAZ2	0.054	0.050	2.996E-6	1276	0.164	0.145	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
5	AFDB:Q9VEW6	0.064	0.073	3.552E-6	924	0.129	0.158	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
6	AFDB:Q92766	0.046	0.035	3.978E-6	1687	0.157	0.106	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
7	AFDB:B8A5T9	0.052	0.059	4.553E-5	927	0.149	0.182	B8A5T9.pdb.gz
8	AFDB:Q13029	0.051	0.039	3.788E-3	1718	0.170	0.112	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
9	AFDB:Q5BIH1	0.043	0.053	1.318E-2	803	0.107	0.151	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
10	AFDB:Q10280	0.042	0.048	1.961E-2	855	0.126	0.166	Q10280.pdb.gz	GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaf1 PE=1 SV=2
11	PDB:4egcA	0.043	0.090	2.275E-1	539	0.011	0.022	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:8cs9g	0.047	0.060	4.754E-1	832	0.014	0.019	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:1tuvA	0.040	0.216	9.934E-1	103	0.011	0.126	1tuvA.pdb.gz	Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
14	PDB:3w5kB	0.032	0.206	1.178	110	0.020	0.209	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:1q53A	0.041	0.222	1.319	112	0.013	0.134	1q53A.pdb.gz
16	PDB:1jwhD	0.032	0.120	1.563	204	0.009	0.049	1jwhD.pdb.gz	Crystal structure of human protein kinase CK2: insights into basic properties of the CK2 holoenzyme.
17	PDB:6wg3C	0.026	0.093	1.655	248	0.018	0.081	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:7v3vI	0.034	0.076	2.325	328	0.035	0.122	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
19	PDB:7pt6I	0.033	0.080	2.460	341	0.026	0.085	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
20	PDB:4fjcE	0.036	0.080	2.756	434	0.013	0.035	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IQ32	0.0	2313	1131	1.000	1.000	ADNP2_HUMAN Activity-dependent neuroprotector homeobox protein 2 OS=Homo sapiens OX=9606 GN=ADNP2 PE=1 SV=1
2	Q8CHC8	0.0	1823	1165	0.799	0.776	ADNP2_MOUSE Activity-dependent neuroprotector homeobox protein 2 OS=Mus musculus OX=10090 GN=Adnp2 PE=1 SV=2
3	A3KQW9	7.35e-94	323	947	0.196	0.234	A3KQW9_DANRE ADNP homeobox 2b OS=Danio rerio OX=7955 GN=si:ch211-129n15.3 PE=1 SV=1
4	A0JMC9	9.52e-93	320	947	0.195	0.233	A0JMC9_DANRE ADNP homeobox 2b OS=Danio rerio OX=7955 GN=si:ch211-129n15.3 PE=1 SV=1
5	A4QP16	2.77e-74	268	962	0.206	0.242	ADN2A_DANRE Activity-dependent neuroprotective protein 2a OS=Danio rerio OX=7955 GN=adnp2a PE=2 SV=1
6	Q9H2P0	5.78e-67	248	1102	0.151	0.155	ADNP_HUMAN Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1
7	Q9JKL8	8.62e-67	248	1103	0.162	0.166	ADNP_RAT Activity-dependent neuroprotector homeobox protein OS=Rattus norvegicus OX=10116 GN=Adnp PE=1 SV=2
8	Q9Z103	6.62e-66	245	1108	0.162	0.165	ADNP_MOUSE Activity-dependent neuroprotector homeobox protein OS=Mus musculus OX=10090 GN=Adnp PE=1 SV=2
9	A0A8M3B615	1.84e-59	224	1016	0.161	0.179	A0A8M3B615_DANRE Activity-dependent neuroprotector homeobox protein isoform X1 OS=Danio rerio OX=7955 GN=adnpb PE=1 SV=1
10	E7F895	2.14e-59	224	1003	0.161	0.181	E7F895_DANRE Activity-dependent neuroprotector homeobox b OS=Danio rerio OX=7955 GN=adnp PE=1 SV=2
11	F1QLG5	2.12e-56	214	969	0.138	0.161	ADN1A_DANRE Activity-dependent neuroprotective protein a OS=Danio rerio OX=7955 GN=adnpa PE=1 SV=1
12	P16112	1.38e-04	48.9	2530	0.096	0.043	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
13	Q9VPQ6	0.013	42.4	1191	0.028	0.027	USH_DROME Zinc finger protein ush OS=Drosophila melanogaster OX=7227 GN=ush PE=1 SV=2
14	O54963	0.040	40.4	1069	0.043	0.046	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
15	Q7Z3K3	0.11	39.3	1410	0.042	0.034	POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2
16	Q9Y4E5	0.15	38.9	1061	0.019	0.020	ZN451_HUMAN E3 SUMO-protein ligase ZNF451 OS=Homo sapiens OX=9606 GN=ZNF451 PE=1 SV=2
17	A8Y5G5	0.17	38.5	1338	0.029	0.025	A8Y5G5_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
18	A2A8R0	0.23	38.1	1397	0.029	0.024	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
19	A0S860	0.47	37.0	706	0.029	0.047	A0S860_MOUSE Zinc finger FYVE domain-containing protein 9 splice variant Z2.1 OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
20	O15090	0.62	36.6	1300	0.022	0.019	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19627 ADNP_N	1.8e-89	312.9	Activity-dependent neuroprotector homeobox protein N-terminal
2	PF15719 DUF4674	22	16.5	Domain of unknown function (DUF4674)
3	PF00046 Homeodomain	14	17.0	Homeodomain
4	PF18868 zf-C2H2_3rep	94	15.1	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	0.55	22.2	C2H2-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377060	0.713	Chromobox protein homolog 1
2	9606.ENSP00000269601	0.706	Thioredoxin-like protein 4A
3	9606.ENSP00000299687	0.702	Zinc finger protein 407
4	9606.ENSP00000307093	0.643	Microtubule-associated protein 6
5	9606.ENSP00000482133	0.642	SYNJ2BP-COX16 readthrough
6	9606.ENSP00000380880	0.630	PQ-loop repeat-containing protein 1
7	9606.ENSP00000009105	0.577	Calcium/calmodulin-dependent protein kinase type 1G
8	9606.ENSP00000361177	0.557	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1
9	9606.ENSP00000331662	0.545	Armadillo repeat-containing X-linked protein 2
10	9606.ENSP00000336687	0.535	Chromobox protein homolog 3
11	9606.ENSP00000260283	0.532	Rho GTPase-activating protein 20
12	9606.ENSP00000360017	0.527	Zinc finger protein 280C
13	9606.ENSP00000323068	0.526	Transmembrane protein 168
14	9606.ENSP00000242819	0.524	Coiled-coil domain containing 70
15	9606.ENSP00000259746	0.522	CSC1-like protein 2
16	9606.ENSP00000368965	0.508	Heparan-alpha-glucosaminide N-acetyltransferase
17	9606.ENSP00000479069	0.506	SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex)
18	9606.ENSP00000462106	0.501	Small integral membrane protein 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.487	heterocyclic compound binding
GO:0097159	0.487	organic cyclic compound binding
GO:0003676	0.464	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0050896	0.937	response to stimulus
GO:0048519	0.890	negative regulation of biological process
GO:0048523	0.809	negative regulation of cellular process
GO:0048518	0.802	positive regulation of biological process
GO:0032502	0.658	developmental process
GO:0042221	0.623	response to chemical
GO:0048856	0.531	anatomical structure development
GO:0051716	0.523	cellular response to stimulus
GO:0032501	0.482	multicellular organismal process
GO:0048522	0.460	positive regulation of cellular process
GO:0030154	0.452	cell differentiation
GO:0007275	0.408	multicellular organism development
GO:0006950	0.392	response to stress
GO:0048731	0.353	system development
GO:0051128	0.346	regulation of cellular component organization
GO:0010033	0.336	response to organic substance
GO:0033554	0.334	cellular response to stress
GO:0071840	0.325	cellular component organization or biogenesis
GO:0019222	0.311	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.990	nucleoplasm
GO:0043228	0.697	non-membrane-bounded organelle
GO:0043232	0.688	intracellular non-membrane-bounded organelle
GO:0005737	0.553	cytoplasm
GO:0016020	0.331	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]