StarFunc result for job id Q6IQ49

User Input

>input (451 residues)
MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSD
TVQHGAVYSLEPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAE
WVKQQAEREAEKEQKRLERLQRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASS
KMVSAEISENRKRQWPTKSQTDRGASAGKRRCFWLGMEGLETAEGSNSESSDDDSEEAPS
TSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPEQLQIPVTDSGRHILEDSCAE
LGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPE
ERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQ
ERAARLFSVRGLAKEQIDPALFAKPLKGKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IQ49	1.000	1.000	4.730E-71	451	1.000	1.000	Q6IQ49.pdb.gz	SDE2_HUMAN Splicing regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2 PE=1 SV=1
2	PDB:3dbhI	0.155	0.686	6.046E-5	86	0.031	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
3	PDB:6mdhA	0.149	0.421	2.113E-4	149	0.016	0.047	6mdhA.pdb.gz
4	PDB:2k1fA	0.143	0.603	3.712E-4	88	0.027	0.136	2k1fA.pdb.gz
5	PDB:7rbsB	0.145	0.387	3.951E-4	157	0.029	0.083	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
6	PDB:6yvaC	0.156	0.424	5.403E-4	155	0.024	0.071	6yvaC.pdb.gz
7	PDB:5xqmA	0.141	0.594	7.865E-4	90	0.029	0.144	5xqmA.pdb.gz
8	PDB:3plvA	0.148	0.721	8.373E-4	80	0.022	0.125	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
9	PDB:1wz0A	0.142	0.539	1.075E-3	104	0.020	0.087	1wz0A.pdb.gz
10	PDB:3ai5A	0.137	0.203	1.145E-3	299	0.016	0.023	3ai5A.pdb.gz
11	PDB:3tixA	0.156	0.389	1.219E-3	153	0.033	0.098	3tixA.pdb.gz
12	AFDB:O42967	0.150	0.115	5.665E-3	603	0.089	0.066	O42967.pdb.gz	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1
13	AFDB:M1BJF6	0.127	0.075	1.448E-2	862	0.140	0.073	M1BJF6.pdb.gz	JOKA2_SOLTU Protein JOKA2 OS=Solanum tuberosum OX=4113 GN=JOKA2 PE=1 SV=1
14	AFDB:Q38C20	0.102	0.082	3.942E-2	588	0.118	0.090	Q38C20.pdb.gz	Q38C20_TRYB2 NTF2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5500 PE=4 SV=1
15	AFDB:Q09003	0.147	0.125	4.196E-2	536	0.120	0.101	Q09003.pdb.gz	COIL_XENLA Coilin OS=Xenopus laevis OX=8355 GN=coil PE=2 SV=2
16	AFDB:B0S7K8	0.142	0.122	6.923E-2	532	0.106	0.090	B0S7K8.pdb.gz	B0S7K8_DANRE Coilin OS=Danio rerio OX=7955 GN=CLN80 PE=1 SV=1
17	AFDB:Q53SF7	0.161	0.070	6.923E-2	1128	0.124	0.050	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
18	AFDB:Q5SU73	0.161	0.129	6.923E-2	570	0.106	0.084	Q5SU73.pdb.gz	COIL_MOUSE Coilin OS=Mus musculus OX=10090 GN=Coil PE=1 SV=1
19	AFDB:D3ZUI5	0.142	0.062	8.892E-2	1133	0.118	0.047	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
20	AFDB:Q960X8	0.121	0.081	2.135E-1	760	0.106	0.063	Q960X8.pdb.gz	HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster OX=7227 GN=Hrs PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IQ49	0.0	926	451	1.000	1.000	SDE2_HUMAN Splicing regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2 PE=1 SV=1
2	Q6DRK2	5.80e-16	82.4	501	0.091	0.082	Q6DRK2_DANRE Splicesome-associated factor 61 OS=Danio rerio OX=7955 GN=zgc:110227 PE=1 SV=1
3	Q12874	1.76e-14	77.8	501	0.086	0.078	SF3A3_HUMAN Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1
4	O46106	4.34e-13	73.2	503	0.091	0.082	NOI_DROME Splicing factor 3A subunit 3 OS=Drosophila melanogaster OX=7227 GN=noi PE=1 SV=1
5	Q22469	2.66e-10	64.7	500	0.067	0.060	Q22469_CAEEL Matrin-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=prp-9 PE=1 SV=2
6	O14113	4.34e-09	59.3	263	0.093	0.160	SDE2_SCHPO Splicing regulator sde2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sde2 PE=1 SV=1
7	Q9FG01	8.46e-08	56.6	504	0.069	0.062	ATO_ARATH Splicing factor SF3a60 homolog OS=Arabidopsis thaliana OX=3702 GN=ATO PE=1 SV=1
8	Q9SE45	1.5	33.5	321	0.069	0.097	ANXD3_ARATH Annexin D3 OS=Arabidopsis thaliana OX=3702 GN=ANN3 PE=2 SV=2
9	Q7LBC6	9.2	31.6	1761	0.042	0.011	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
10	G5EEI1	9.7	31.2	941	0.042	0.020	G5EEI1_CAEEL LGL-1 OS=Caenorhabditis elegans OX=6239 GN=lgl-1 PE=1 SV=1
11	P67087	10.0	30.8	286	0.055	0.087	RSMI_ECOLI Ribosomal RNA small subunit methyltransferase I OS=Escherichia coli (strain K12) OX=83333 GN=rsmI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15353 HECA	2.4e+02	13.3	Headcase protein family homologue
2	PF09511 RNA_lig_T4_1	62	14.9	RNA ligase
3	PF13297 SDE2_2C	3.9e-25	98.9	Replication stress response SDE2 C-terminal
4	PF13019 Sde2_N_Ubi	5.8e-20	83.3	Silencing defective 2 N-terminal ubiquitin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272091

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357928	0.973	Pre-mRNA-processing factor 17
2	9606.ENSP00000366557	0.969	Crooked neck-like protein 1
3	9606.ENSP00000263384	0.965	Protein FAM32A
4	9606.ENSP00000415078	0.964	Cactin
5	9606.ENSP00000297151	0.962	Pre-mRNA-splicing factor SLU7
6	9606.ENSP00000227524	0.957	Pre-mRNA-processing factor 19
7	9606.ENSP00000386023	0.956	Protein BUD31 homolog
8	9606.ENSP00000419270	0.954	PRKR-interacting protein 1
9	9606.ENSP00000360532	0.943	Cell division cycle 5-like protein
10	9606.ENSP00000317123	0.933	U5 small nuclear ribonucleoprotein 200 kDa helicase
11	9606.ENSP00000475615	0.917	Spliceosome-associated protein CWC15 homolog
12	9606.ENSP00000236273	0.915	Pre-mRNA-splicing factor SYF2
13	9606.ENSP00000199814	0.914	Pre-mRNA-splicing factor RBM22
14	9606.ENSP00000358554	0.914	Pre-mRNA-splicing factor SPF27
15	9606.ENSP00000392094	0.908	116 kDa U5 small nuclear ribonucleoprotein component
16	9606.ENSP00000263694	0.907	U5 small nuclear ribonucleoprotein 40 kDa protein
17	9606.ENSP00000254193	0.902	U2 small nuclear ribonucleoprotein A
18	9606.ENSP00000412566	0.879	Small nuclear ribonucleoprotein-associated proteins B and B
19	9606.ENSP00000301740	0.868	Serine/arginine repetitive matrix protein 2
20	9606.ENSP00000463058	0.863	RNA-binding protein 8A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030515	1.000	snoRNA binding
GO:0003684	1.000	damaged DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0000398	0.979	mRNA splicing, via spliceosome
GO:0050794	0.975	regulation of cellular process
GO:0006974	0.972	cellular response to DNA damage stimulus
GO:0048523	0.969	negative regulation of cellular process
GO:0022613	0.968	ribonucleoprotein complex biogenesis
GO:0035556	0.939	intracellular signal transduction
GO:1901988	0.936	negative regulation of cell cycle phase transition
GO:0000278	0.926	mitotic cell cycle
GO:0000077	0.926	DNA damage checkpoint signaling
GO:1901990	0.915	regulation of mitotic cell cycle phase transition
GO:0007093	0.909	mitotic cell cycle checkpoint signaling
GO:0009628	0.892	response to abiotic stimulus
GO:0009314	0.844	response to radiation
GO:0044774	0.811	mitotic DNA integrity checkpoint signaling
GO:1901991	0.777	negative regulation of mitotic cell cycle phase transition
GO:1902806	0.775	regulation of cell cycle G1/S phase transition
GO:2000045	0.773	regulation of G1/S transition of mitotic cell cycle
GO:0104004	0.751	cellular response to environmental stimulus
GO:0044773	0.750	mitotic DNA damage checkpoint signaling
GO:2000134	0.746	negative regulation of G1/S transition of mitotic cell cycle
GO:0009416	0.642	response to light stimulus
GO:0009411	0.605	response to UV
GO:0071478	0.564	cellular response to radiation
GO:0071482	0.546	cellular response to light stimulus
GO:0019538	0.436	protein metabolic process
GO:0036211	0.434	protein modification process
GO:0034644	0.359	cellular response to UV
GO:0090501	0.355	RNA phosphodiester bond hydrolysis
GO:0034660	0.351	ncRNA metabolic process
GO:0034470	0.333	ncRNA processing
GO:0006508	0.313	proteolysis
GO:0070647	0.310	protein modification by small protein conjugation or removal
GO:0090502	0.307	RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0031571	0.303	mitotic G1 DNA damage checkpoint signaling
GO:0042254	0.301	ribosome biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.998	plasma membrane
GO:0016607	0.998	nuclear speck
GO:0005794	0.997	Golgi apparatus
GO:0032991	0.531	protein-containing complex
GO:0043232	0.384	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]