StarFunc result for job id Q6IQ55

User Input

>input (1244 residues)
MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQV
LKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLR
LGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPP
RAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKE
RYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKT
GNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIP
VGVSPDKLPGSLGHPRPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSL
GSPIRVRSEITQPDRDIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSA
GKESILPALLHKPCVPAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNL
SSCKQEIDSKEWVIVDKEQDLQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQL
GPWAENDHLKKETSGVVLALSAEGPPTAASEQYTDRLELQPGAASQFIAATPTSLMEAQA
EGPLTAITIPRPSVASTQSTSGSFHCGQQPEKKDLQPMEPTVELYSPRENFSGLVVTEGE
PPSGGSRTDLGLQIDHIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREFENLPGETEEK
SILLESDNEDEKLSRGQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKN
NEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFL
HQEGKREKITPRNGELFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSS
PVSAKEKLLQKKAYQPDLVKLLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVL
TPFSRLTVDSHLSRSAEDSFLSPIISQSRKSKIPRPVSWVNTDQVNSSTSSQFFPRPPPG
KPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQKPRSTTQCKSPGSPHNPKTP
PKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSS
RRSCQQEHCKPSKNGLKGSGSLHHHSASTKTPQGKSKPASKLSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UVR3	0.325	0.325	0.000	1243	0.897	0.898	Q3UVR3.pdb.gz	TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1
2	AFDB:Q6IQ55	0.999	0.999	0.000	1244	1.000	1.000	Q6IQ55.pdb.gz	TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TTBK2 PE=1 SV=2
3	AFDB:Q5TCY1	0.260	0.245	2.337E-65	1321	0.390	0.367	Q5TCY1.pdb.gz	TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TTBK1 PE=1 SV=2
4	AFDB:L0MLK2	0.240	0.261	1.982E-54	1144	0.269	0.293	L0MLK2.pdb.gz	L0MLK2_DROME Asator, isoform G OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
5	AFDB:Q8IMC6	0.241	0.237	5.023E-54	1262	0.283	0.279	Q8IMC6.pdb.gz	ASATR_DROME Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2
6	PDB:6gzdA	0.222	0.899	1.608E-28	297	0.085	0.357	6gzdA.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
7	PDB:6pxnA	0.220	0.906	1.551E-27	290	0.085	0.366	6pxnA.pdb.gz
8	PDB:2rsvA	0.201	0.568	2.493E-16	403	0.076	0.236	2rsvA.pdb.gz
9	AFDB:Q9Y2K2	0.153	0.145	1.741E-15	1321	0.175	0.165	Q9Y2K2.pdb.gz	SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3 PE=1 SV=4
10	AFDB:Q9W532	0.168	0.150	3.706E-15	1398	0.165	0.147	Q9W532.pdb.gz	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
11	PDB:4krcA	0.189	0.721	4.300E-15	297	0.046	0.192	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
12	AFDB:Q6P4S6	0.159	0.151	5.899E-15	1311	0.169	0.160	Q6P4S6.pdb.gz	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
13	PDB:5u6yA	0.182	0.464	1.224E-14	459	0.051	0.137	5u6yA.pdb.gz
14	AFDB:A1ZBC4	0.159	0.136	1.679E-14	1471	0.150	0.127	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
15	AFDB:B9X2H6	0.177	0.202	1.679E-14	1080	0.141	0.162	B9X2H6.pdb.gz	B9X2H6_DANRE Cyclin dependent kinase like 5 long OS=Danio rerio OX=7955 GN=Cdkl5 PE=2 SV=1
16	PDB:1unlA	0.172	0.654	6.230E-14	292	0.047	0.202	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
17	PDB:6qx9K	0.183	0.648	6.230E-14	322	0.047	0.183	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:5oniA	0.184	0.626	8.829E-14	334	0.049	0.183	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
19	PDB:4eomC	0.191	0.786	1.326E-13	276	0.044	0.199	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:6b1uA	0.185	0.496	1.326E-13	442	0.045	0.127	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTK1	0.0	690	1307	0.289	0.275	A0A0G2JTK1_RAT Tau tubulin kinase 1 OS=Rattus norvegicus OX=10116 GN=Ttbk1 PE=1 SV=2
2	A0A0G2JYZ1	0.0	2158	1242	0.900	0.902	A0A0G2JYZ1_RAT Tau tubulin kinase 2 OS=Rattus norvegicus OX=10116 GN=Ttbk2 PE=1 SV=1
3	Q3UVR3	0.0	2156	1243	0.898	0.899	TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1
4	Q5TCY1	0.0	689	1321	0.289	0.273	TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TTBK1 PE=1 SV=2
5	Q6IQ55	0.0	2552	1244	1.000	1.000	TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TTBK2 PE=1 SV=2
6	Q6PCN3	0.0	689	1308	0.289	0.275	TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=Ttbk1 PE=1 SV=3
7	Q8IWY7	0.0	1975	1649	0.780	0.588	Q8IWY7_HUMAN Tau-tubulin kinase OS=Homo sapiens OX=9606 PE=1 SV=1
8	L0MLN1	2.97e-157	502	1106	0.185	0.208	L0MLN1_DROME Asator, isoform K OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
9	L0MLK2	3.83e-157	503	1144	0.185	0.201	L0MLK2_DROME Asator, isoform G OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
10	L0MPN7	8.40e-157	503	1193	0.185	0.193	L0MPN7_DROME Asator, isoform H OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
11	L0MN72	4.63e-156	503	1261	0.185	0.182	L0MN72_DROME Asator, isoform J OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
12	Q8IMC6	5.59e-156	503	1262	0.185	0.182	ASATR_DROME Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2
13	L0MPX5	1.72e-155	503	1348	0.185	0.171	L0MPX5_DROME Asator, isoform I OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
14	Q9V4D6	2.94e-155	503	1349	0.185	0.170	Q9V4D6_DROME Asator, isoform D OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=3
15	Q95PZ9	8.28e-49	181	379	0.078	0.256	SPE6_CAEEL Serine/threonine-protein kinase spe-6 OS=Caenorhabditis elegans OX=6239 GN=spe-6 PE=1 SV=1
16	P42168	3.35e-47	174	341	0.095	0.346	KC1A_CAEEL Casein kinase I isoform alpha OS=Caenorhabditis elegans OX=6239 GN=kin-19 PE=3 SV=1
17	Q5BP74	6.18e-47	176	415	0.087	0.260	KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis OX=8355 GN=csnk1d PE=1 SV=2
18	A7MB68	1.28e-46	175	409	0.085	0.259	A7MB68_BOVIN CSNK1D protein OS=Bos taurus OX=9913 GN=CSNK1D PE=2 SV=1
19	Q06486	1.45e-46	175	415	0.087	0.260	KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus OX=10116 GN=Csnk1d PE=1 SV=2
20	Q9DC28	1.45e-46	175	415	0.087	0.260	KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus OX=10090 GN=Csnk1d PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	1.2e-26	105.3	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	1.5e-14	65.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278935	0.990	Centrosomal protein of 164 kDa
2	9606.ENSP00000370803	0.841	Centriolar coiled-coil protein of 110 kDa
3	9606.ENSP00000439585	0.830	Ataxin-7
4	9606.ENSP00000363055	0.771	ZW10 interactor
5	9606.ENSP00000281142	0.754	Sodium channel and clathrin linker 1
6	9606.ENSP00000432568	0.748	Spectrin beta chain, non-erythrocytic 2
7	9606.ENSP00000380911	0.743	Centrosomal protein of 83 kDa
8	9606.ENSP00000324292	0.739	Fas-binding factor 1
9	9606.ENSP00000342510	0.732	Centrosomal protein of 97 kDa
10	9606.ENSP00000306105	0.713	Centrosomal protein of 89 kDa
11	9606.ENSP00000356448	0.705	Nucleoprotein TPR
12	9606.ENSP00000434241	0.690	Potassium voltage-gated channel subfamily C member 3
13	9606.ENSP00000365301	0.685	Fibroblast growth factor 14
14	9606.ENSP00000252934	0.682	Ataxin-10
15	9606.ENSP00000334379	0.659	C2 domain-containing protein 3
16	9606.ENSP00000323580	0.645	Intraflagellar transport protein 88 homolog
17	9606.ENSP00000377936	0.633	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
18	9606.ENSP00000263431	0.619	Protein kinase C gamma type
19	9606.ENSP00000269143	0.617	AFG3-like protein 2
20	9606.ENSP00000356579	0.598	Centrosome-associated protein 350

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0008092	0.911	cytoskeletal protein binding
GO:0015631	0.869	tubulin binding
GO:0050321	0.866	tau-protein kinase activity
GO:0051010	0.864	microtubule plus-end binding
GO:0019894	0.855	kinesin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071840	0.983	cellular component organization or biogenesis
GO:0051128	0.981	regulation of cellular component organization
GO:0044782	0.970	cilium organization
GO:0033043	0.966	regulation of organelle organization
GO:0048519	0.953	negative regulation of biological process
GO:0071704	0.944	organic substance metabolic process
GO:0044238	0.938	primary metabolic process
GO:0048523	0.934	negative regulation of cellular process
GO:0006468	0.934	protein phosphorylation
GO:0022607	0.916	cellular component assembly
GO:0070925	0.827	organelle assembly
GO:0030031	0.798	cell projection assembly
GO:0060271	0.768	cilium assembly
GO:0032886	0.650	regulation of microtubule-based process
GO:0051129	0.486	negative regulation of cellular component organization
GO:0060341	0.352	regulation of cellular localization
GO:0051493	0.307	regulation of cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0015630	1.000	microtubule cytoskeleton
GO:0005829	0.991	cytosol
GO:0005814	0.990	centriole
GO:0005929	0.987	cilium
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0005634	0.953	nucleus
GO:0035869	0.771	ciliary transition zone
GO:0005576	0.458	extracellular region
GO:0036064	0.337	ciliary basal body
GO:0043233	0.328	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.26	0.866	[tau protein] kinase.

[back to server]