StarFunc result for job id Q6ISB3

User Input

>input (625 residues)
MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDS
AAALGLLYDYYKVPRDKRLLSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTV
PVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGE
EQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMY
DQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVV
MVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAYNAVSFTWD
VNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKG
AERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVL
FIPDVHFANLQRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRVLL
YVRKETDDVFDALMLKSPTVKGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEH
YSNEDTFILNMESMVEGFKVTLMEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ISB3	1.000	1.000	0.000	625	1.000	1.000	Q6ISB3.pdb.gz	GRHL2_HUMAN Grainyhead-like protein 2 homolog OS=Homo sapiens OX=9606 GN=GRHL2 PE=1 SV=1
2	AFDB:Q921D9	0.360	0.364	2.907E-75	618	0.574	0.581	Q921D9.pdb.gz	GRHL1_MOUSE Grainyhead-like protein 1 homolog OS=Mus musculus OX=10090 GN=Grhl1 PE=1 SV=1
3	AFDB:E7FCE3	0.378	0.386	1.004E-73	613	0.574	0.586	E7FCE3.pdb.gz	E7FCE3_DANRE Grainyhead-like protein 1 homolog isoform X1 OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=1
4	AFDB:Q8TE85	0.348	0.347	3.883E-54	626	0.438	0.438	Q8TE85.pdb.gz	GRHL3_HUMAN Grainyhead-like protein 3 homolog OS=Homo sapiens OX=9606 GN=GRHL3 PE=1 SV=3
5	PDB:6xreM	0.148	0.269	2.982E-5	314	0.062	0.124	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
6	AFDB:Q6AWC2	0.116	0.072	1.404E-4	1192	0.112	0.059	Q6AWC2.pdb.gz	WWC2_HUMAN Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2
7	AFDB:Q9Y2G1	0.131	0.078	1.676E-4	1151	0.080	0.043	Q9Y2G1.pdb.gz	MYRF_HUMAN Myelin regulatory factor OS=Homo sapiens OX=9606 GN=MYRF PE=1 SV=3
8	AFDB:O94432	0.060	0.072	4.311E-4	474	0.096	0.127	O94432.pdb.gz	YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC660.15 PE=4 SV=1
9	PDB:1q90A	0.121	0.221	1.230E-3	292	0.027	0.058	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
10	AFDB:P79944	0.132	0.122	1.489E-3	692	0.090	0.081	P79944.pdb.gz	EOMES_XENLA Eomesodermin OS=Xenopus laevis OX=8355 GN=eomes PE=2 SV=1
11	AFDB:Q24432	0.111	0.076	1.489E-3	972	0.107	0.069	Q24432.pdb.gz	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
12	AFDB:A0A1D5PFK3	0.077	0.061	1.778E-3	896	0.093	0.065	A0A1D5PFK3.pdb.gz
13	PDB:4aq1A	0.124	0.110	2.219E-3	721	0.026	0.022	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:1yvlB	0.103	0.100	3.354E-3	653	0.026	0.025	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
15	PDB:7ea3J	0.139	0.103	4.004E-3	883	0.027	0.019	7ea3J.pdb.gz
16	PDB:5ir3A	0.088	0.287	5.379E-3	111	0.034	0.189	5ir3A.pdb.gz
17	PDB:3oaiA	0.109	0.135	6.421E-3	488	0.021	0.027	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
18	PDB:7tvzE	0.123	0.117	6.421E-3	665	0.030	0.029	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
19	PDB:5kwyC	0.124	0.435	7.665E-3	133	0.030	0.143	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
20	PDB:1kiuB	0.092	0.164	9.150E-3	279	0.027	0.061	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YAF2	0.0	677	601	0.581	0.604	A0A286YAF2_DANRE Grainyhead-like protein 1 homolog OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=2
2	A0A2R8QAV0	0.0	802	554	0.651	0.735	A0A2R8QAV0_DANRE Grainyhead-like protein 2 homolog OS=Danio rerio OX=7955 GN=grhl2 PE=4 SV=1
3	E7FCE3	0.0	683	613	0.590	0.602	E7FCE3_DANRE Grainyhead-like protein 1 homolog isoform X1 OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=1
4	F7VJQ5	0.0	870	601	0.709	0.737	F7VJQ5_DANRE Grainyhead-like 2b protein OS=Danio rerio OX=7955 GN=grhl2 PE=2 SV=1
5	Q6ISB3	0.0	1308	625	1.000	1.000	GRHL2_HUMAN Grainyhead-like protein 2 homolog OS=Homo sapiens OX=9606 GN=GRHL2 PE=1 SV=1
6	Q8K5C0	0.0	1251	625	0.947	0.947	GRHL2_MOUSE Grainyhead-like protein 2 homolog OS=Mus musculus OX=10090 GN=Grhl2 PE=2 SV=1
7	Q921D9	0.0	699	618	0.589	0.595	GRHL1_MOUSE Grainyhead-like protein 1 homolog OS=Mus musculus OX=10090 GN=Grhl1 PE=1 SV=1
8	Q9NZI5	0.0	691	618	0.581	0.587	GRHL1_HUMAN Grainyhead-like protein 1 homolog OS=Homo sapiens OX=9606 GN=GRHL1 PE=1 SV=2
9	Q5FWH3	8.01e-164	483	603	0.458	0.474	GRHL3_MOUSE Grainyhead-like protein 3 homolog OS=Mus musculus OX=10090 GN=Grhl3 PE=1 SV=1
10	Q8TE85	8.39e-157	466	626	0.432	0.431	GRHL3_HUMAN Grainyhead-like protein 3 homolog OS=Homo sapiens OX=9606 GN=GRHL3 PE=1 SV=3
11	G5EDF0	2.47e-80	266	563	0.256	0.284	GRH1_CAEEL Grainyhead-like protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=grh-1 PE=2 SV=1
12	P13002	3.01e-57	211	1333	0.184	0.086	ELF1_DROME Protein grainyhead OS=Drosophila melanogaster OX=7227 GN=grh PE=1 SV=3
13	F8VX55	4.99e-25	110	424	0.170	0.250	F8VX55_HUMAN Transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2 PE=1 SV=1
14	Q9NZI6	8.01e-22	101	479	0.117	0.152	TF2L1_HUMAN Transcription factor CP2-like protein 1 OS=Homo sapiens OX=9606 GN=TFCP2L1 PE=1 SV=1
15	Q3UNW5	8.61e-22	101	479	0.117	0.152	TF2L1_MOUSE Transcription factor CP2-like protein 1 OS=Mus musculus OX=10090 GN=Tfcp2l1 PE=1 SV=2
16	Q811S7	1.15e-20	98.2	540	0.110	0.128	UBIP1_MOUSE Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1
17	Q9NZI7	3.86e-20	96.7	540	0.110	0.128	UBIP1_HUMAN Upstream-binding protein 1 OS=Homo sapiens OX=9606 GN=UBP1 PE=1 SV=1
18	Q9ERA0	7.71e-20	95.5	502	0.122	0.151	TFCP2_MOUSE Alpha-globin transcription factor CP2 OS=Mus musculus OX=10090 GN=Tfcp2 PE=1 SV=1
19	A0A8I6AB07	1.43e-19	94.7	497	0.112	0.141	A0A8I6AB07_RAT Transcription factor CP2 OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=1 SV=1
20	G3V969	1.45e-19	94.4	497	0.122	0.153	G3V969_RAT Tcfcp2 protein OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04516 CP2	1.3e-82	288.1	CP2 transcription factor
2	PF20306 Sp-DndD	12	17.5	Small protein found in certain Dnd DNA modification systems

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251808

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278780	0.872	Transcription factor Ovo-like 2
2	9606.ENSP00000405738	0.798	Epithelial splicing regulatory protein 1
3	9606.ENSP00000354376	0.741	Ras-related protein Rab-25
4	9606.ENSP00000409544	0.738	Claudin-4
5	9606.ENSP00000250448	0.704	Hepatocyte nuclear factor 3-alpha
6	9606.ENSP00000261769	0.679	Cadherin-1
7	9606.ENSP00000354487	0.651	Zinc finger E-box-binding homeobox 1
8	9606.ENSP00000337862	0.650	Putative transcription factor Ovo-like 1
9	9606.ENSP00000359575	0.648	LIM domain transcription factor LMO4
10	9606.ENSP00000263735	0.636	Epithelial cell adhesion molecule
11	9606.ENSP00000234396	0.630	V-type proton ATPase subunit B, kidney isoform
12	9606.ENSP00000319829	0.551	Zinc finger protein 687
13	9606.ENSP00000377823	0.548	Protein NDRG4
14	9606.ENSP00000239165	0.546	Homeobox protein Hox-B7
15	9606.ENSP00000353475	0.534	Claudin-7
16	9606.ENSP00000259915	0.533	POU domain, class 5, transcription factor 1
17	9606.ENSP00000405330	0.527	Estrogen receptor
18	9606.ENSP00000339587	0.523	Gasdermin-E
19	9606.ENSP00000262916	0.512	Potassium voltage-gated channel subfamily KQT member 4
20	9606.ENSP00000379709	0.508	Rho GTPase-activating protein 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0005515	0.999	protein binding
GO:0000981	0.996	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.947	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0031490	0.946	chromatin DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0051173	0.975	positive regulation of nitrogen compound metabolic process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0009653	0.967	anatomical structure morphogenesis
GO:0048513	0.960	animal organ development
GO:0006357	0.960	regulation of transcription by RNA polymerase II
GO:0010557	0.956	positive regulation of macromolecule biosynthetic process
GO:0045935	0.951	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.948	positive regulation of cellular biosynthetic process
GO:0032501	0.902	multicellular organismal process
GO:0045893	0.897	positive regulation of DNA-templated transcription
GO:0009888	0.872	tissue development
GO:0045944	0.847	positive regulation of transcription by RNA polymerase II
GO:0007275	0.814	multicellular organism development
GO:0060429	0.751	epithelium development
GO:0048731	0.657	system development
GO:0048519	0.567	negative regulation of biological process
GO:0048523	0.551	negative regulation of cellular process
GO:0071840	0.410	cellular component organization or biogenesis
GO:0007399	0.375	nervous system development
GO:0008544	0.374	epidermis development
GO:0016043	0.370	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.979	nucleoplasm
GO:0005737	0.684	cytoplasm
GO:0030054	0.423	cell junction
GO:0005911	0.311	cell-cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]