StarFunc result for job id Q6J4K2

User Input

>input (584 residues)
MAGRRLNLRWALSVLCVLLMAETVSGTRGSSTGAHISPQFPASGVNQTPVVDCRKVCGLN
VSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK
FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAFSDPHTAGLALGALFGAGVL
VTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFY
VVTVILCTWIYQRQRRGSLFCPMPVTPEILSDSEEDRVSSNTNSYDYGDEYRPLFFYQET
TAQILVRALNPLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNC
LHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWL
FAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLAR
QGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVF
SLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHLKSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6J4K2	1.000	1.000	5.396E-73	584	1.000	1.000	Q6J4K2.pdb.gz	NCLX_HUMAN Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2
2	AFDB:Q6AXS0	0.909	0.907	3.697E-62	585	0.829	0.827	Q6AXS0.pdb.gz	NCLX_RAT Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1
3	AFDB:F1NXU8	0.867	0.854	1.010E-51	593	0.661	0.651	F1NXU8.pdb.gz	NCLX_CHICK Mitochondrial sodium/calcium exchanger protein OS=Gallus gallus OX=9031 GN=SLC8B1 PE=3 SV=4
4	AFDB:Q9LJI2	0.750	0.687	4.119E-24	643	0.276	0.250	Q9LJI2.pdb.gz	CCX3_ARATH Cation/calcium exchanger 3 OS=Arabidopsis thaliana OX=3702 GN=CCX3 PE=2 SV=1
5	AFDB:P87122	0.606	0.493	3.429E-23	743	0.300	0.236	P87122.pdb.gz	YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A12.06c PE=3 SV=1
6	AFDB:O04034	0.706	0.751	2.971E-22	546	0.264	0.282	O04034.pdb.gz	CCX5_ARATH Cation/calcium exchanger 5 OS=Arabidopsis thaliana OX=3702 GN=CCX5 PE=2 SV=1
7	AFDB:O16242	0.644	0.586	4.431E-22	651	0.286	0.257	O16242.pdb.gz	NCX9_CAEEL Mitochondrial sodium/calcium exchanger protein OS=Caenorhabditis elegans OX=6239 GN=ncx-9 PE=1 SV=1
8	AFDB:Q9SYG9	0.627	0.577	1.593E-21	644	0.264	0.239	Q9SYG9.pdb.gz	CCX4_ARATH Cation/calcium exchanger 4 OS=Arabidopsis thaliana OX=3702 GN=CCX4 PE=2 SV=1
9	AFDB:Q9FKP2	0.615	0.638	1.978E-20	559	0.289	0.302	Q9FKP2.pdb.gz	CCX2_ARATH Cation/calcium exchanger 2 OS=Arabidopsis thaliana OX=3702 GN=CCX2 PE=3 SV=1
10	AFDB:F1RAZ0	0.520	0.505	3.079E-15	602	0.193	0.188	F1RAZ0.pdb.gz
11	PDB:4k1cA	0.285	0.411	2.491E-1	374	0.080	0.126	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.
12	PDB:6x15A	0.104	0.128	3.571E-1	419	0.103	0.143	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
13	PDB:7t9gA	0.106	0.124	4.190E-1	445	0.110	0.144	7t9gA.pdb.gz	Structural basis of ion - substrate coupling in the Na + -dependent dicarboxylate transporter VcINDY.
14	PDB:2o7dA	0.089	0.097	4.539E-1	515	0.111	0.126	2o7dA.pdb.gz	Structural determinants and modulation of substrate specificity in phenylalanine-tyrosine ammonia-lyases.
15	PDB:3kdzA	0.094	0.103	5.543E-1	527	0.072	0.080	3kdzA.pdb.gz	Probing the active site of MIO-dependent aminomutases, key catalysts in the biosynthesis of beta-amino acids incorporated in secondary metabolites
16	PDB:8cs9g	0.121	0.096	6.504E-1	832	0.110	0.077	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:7zh0A	0.098	0.110	7.333E-1	495	0.099	0.117	7zh0A.pdb.gz
18	PDB:4yzfA	0.100	0.117	7.633E-1	475	0.135	0.166	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
19	PDB:7p5cA	0.067	0.086	9.322E-1	392	0.084	0.125	7p5cA.pdb.gz
20	PDB:7d10A	0.096	0.115	1.094	446	0.115	0.150	7d10A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NXU8	0.0	710	593	0.663	0.653	NCLX_CHICK Mitochondrial sodium/calcium exchanger protein OS=Gallus gallus OX=9031 GN=SLC8B1 PE=3 SV=4
2	Q6AXS0	0.0	971	585	0.829	0.827	NCLX_RAT Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1
3	Q6J4K2	0.0	1176	584	1.000	1.000	NCLX_HUMAN Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2
4	Q925Q3	0.0	974	585	0.829	0.827	NCLX_MOUSE Mitochondrial sodium/calcium exchanger protein OS=Mus musculus OX=10090 GN=Slc8b1 PE=2 SV=2
5	Q9SYG9	2.46e-56	202	644	0.265	0.241	CCX4_ARATH Cation/calcium exchanger 4 OS=Arabidopsis thaliana OX=3702 GN=CCX4 PE=2 SV=1
6	Q9LJI2	2.57e-56	202	643	0.271	0.246	CCX3_ARATH Cation/calcium exchanger 3 OS=Arabidopsis thaliana OX=3702 GN=CCX3 PE=2 SV=1
7	O04034	1.03e-48	179	546	0.262	0.280	CCX5_ARATH Cation/calcium exchanger 5 OS=Arabidopsis thaliana OX=3702 GN=CCX5 PE=2 SV=1
8	Q9FKP2	1.27e-45	171	559	0.300	0.313	CCX2_ARATH Cation/calcium exchanger 2 OS=Arabidopsis thaliana OX=3702 GN=CCX2 PE=3 SV=1
9	O16242	4.26e-29	124	651	0.127	0.114	NCX9_CAEEL Mitochondrial sodium/calcium exchanger protein OS=Caenorhabditis elegans OX=6239 GN=ncx-9 PE=1 SV=1
10	P87122	2.31e-27	119	743	0.146	0.114	YDL6_SCHPO Putative cation exchanger C3A12.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A12.06c PE=3 SV=1
11	Q8C261	5.76e-24	107	501	0.195	0.228	NCKX5_MOUSE Sodium/potassium/calcium exchanger 5 OS=Mus musculus OX=10090 GN=Slc24a5 PE=2 SV=1
12	F1QXK9	2.47e-20	97.4	636	0.204	0.187	F1QXK9_DANRE Sodium/potassium/calcium exchanger 4 OS=Danio rerio OX=7955 GN=slc24a4b PE=3 SV=1
13	Q71RS6	3.99e-17	86.7	500	0.188	0.220	NCKX5_HUMAN Sodium/potassium/calcium exchanger 5 OS=Homo sapiens OX=9606 GN=SLC24A5 PE=1 SV=1
14	Q8BUN9	9.71e-14	76.6	666	0.094	0.083	NCKX2_MOUSE Sodium/potassium/calcium exchanger 2 OS=Mus musculus OX=10090 GN=Slc24a2 PE=1 SV=1
15	Q9HC58	1.19e-13	76.3	644	0.099	0.090	NCKX3_HUMAN Sodium/potassium/calcium exchanger 3 OS=Homo sapiens OX=9606 GN=SLC24A3 PE=2 SV=4
16	Q9UI40	1.20e-13	76.3	661	0.110	0.097	NCKX2_HUMAN Sodium/potassium/calcium exchanger 2 OS=Homo sapiens OX=9606 GN=SLC24A2 PE=1 SV=1
17	O54701	1.33e-13	76.3	670	0.098	0.085	NCKX2_RAT Sodium/potassium/calcium exchanger 2 OS=Rattus norvegicus OX=10116 GN=Slc24a2 PE=1 SV=1
18	Q9EPQ0	3.54e-13	74.7	624	0.099	0.093	NCKX3_RAT Sodium/potassium/calcium exchanger 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Slc24a3 PE=1 SV=1
19	Q99PD7	3.71e-13	74.7	645	0.099	0.090	NCKX3_MOUSE Sodium/potassium/calcium exchanger 3 OS=Mus musculus OX=10090 GN=Slc24a3 PE=1 SV=3
20	Q9IAL8	1.74e-12	72.8	663	0.104	0.092	NCKX1_CHICK Sodium/potassium/calcium exchanger 1 OS=Gallus gallus OX=9031 GN=SLC24A1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01699 Na_Ca_ex	7.9e-45	163.9	Sodium/calcium exchanger protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447091

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362144	0.897	Calcium uniporter protein, mitochondrial
2	9606.ENSP00000354415	0.884	Calcium uptake protein 1, mitochondrial
3	9606.ENSP00000305653	0.828	Mitochondrial proton/calcium exchanger protein
4	9606.ENSP00000378145	0.774	Calcium uniporter regulatory subunit MCUb, mitochondrial
5	9606.ENSP00000371811	0.773	Calcium uptake protein 2, mitochondrial
6	9606.ENSP00000368468	0.716	Mitochondrial calcium uniporter regulator 1
7	9606.ENSP00000370669	0.703	Sodium/calcium exchanger 3
8	9606.ENSP00000321455	0.686	Calcium uptake protein 3, mitochondrial
9	9606.ENSP00000361475	0.677	Neuronal calcium sensor 1
10	9606.ENSP00000236877	0.676	Sodium/calcium exchanger 2
11	9606.ENSP00000349320	0.674	Voltage-dependent calcium channel subunit alpha-2/delta-1
12	9606.ENSP00000348752	0.664	Protein orai-2
13	9606.ENSP00000384763	0.642	Sodium/calcium exchanger 1
14	9606.ENSP00000377840	0.622	Voltage-dependent L-type calcium channel subunit beta-1
15	9606.ENSP00000225174	0.605	Peptidyl-prolyl cis-trans isomerase F, mitochondrial
16	9606.ENSP00000327467	0.594	Essential MCU regulator, mitochondrial
17	9606.ENSP00000480616	0.589	Calcium release-activated calcium channel protein 1
18	9606.ENSP00000480916	0.548	Sodium/hydrogen exchanger 7
19	9606.ENSP00000265333	0.540	Voltage-dependent anion-selective channel protein 1
20	9606.ENSP00000416418	0.532	Sodium/hydrogen exchanger 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0005432	1.000	calcium:sodium antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0055082	0.991	intracellular chemical homeostasis
GO:0055074	0.990	calcium ion homeostasis
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0006810	0.984	transport
GO:0070588	0.967	calcium ion transmembrane transport
GO:0006874	0.965	intracellular calcium ion homeostasis
GO:1990542	0.945	mitochondrial transmembrane transport
GO:0032879	0.934	regulation of localization
GO:0051560	0.890	mitochondrial calcium ion homeostasis
GO:0048523	0.882	negative regulation of cellular process
GO:0051283	0.868	negative regulation of sequestering of calcium ion
GO:0097553	0.830	calcium ion transmembrane import into cytosol
GO:0065008	0.768	regulation of biological quality
GO:0051480	0.721	regulation of cytosolic calcium ion concentration
GO:0051209	0.672	release of sequestered calcium ion into cytosol
GO:0042391	0.376	regulation of membrane potential
GO:0051049	0.358	regulation of transport
GO:0048583	0.300	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005739	1.000	mitochondrion
GO:0031090	0.995	organelle membrane
GO:0031975	0.941	envelope
GO:0031967	0.929	organelle envelope
GO:0005740	0.909	mitochondrial envelope
GO:0031966	0.903	mitochondrial membrane
GO:0005743	0.883	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29255	1.000	Ca(2+)(in) + Na(+)(out) = Ca(2+)(out) + Na(+)(in)

[back to server]