StarFunc result for job id Q6JQN1

User Input

>input (1059 residues)
MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRV
AAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVD
SFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVE
SCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKE
LEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGPLELLQFDHGQSNPTY
YIRLANRDLVLRKKPPGTLLPSAHAIEREFRIMKALANAGVPVPNVLDLCEDSSVIGTPF
YVMEYCPGLIYKDPSLPGLEPSHRRAIYTAMNTVLCKIHSVDLQAVGLEDYGKQGDYIPR
QVRTWVKQYRASETSTIPAMERLIEWLPLHLPRQQRTTVVHGDFRLDNLVFHPEEPEVLA
VLDWELSTLGDPLADVAYSCLAHYLPSSFPVLRGINDCDLTQLGIPAAEEYFRMYCLQMG
LPPTENWNFYMAFSFFRVAAILQGVYKRSLTGQASSTYAEQTGKLTEFVSNLAWDFAVKE
GFRVFKEMPFTNPLTRSYHTWARPQSQWCPTGSRSYSSVPEASPAHTSRGGLVISPESLS
PPVRELYHRLKHFMEQRVYPAEPELQSHQASAARWSPSPLIEDLKEKAKAEGLWNLFLPL
EADPEKKYGAGLTNVEYAHLCELMGTSLYAPEVCNCSAPDTGNMELLVRYGTEAQKARWL
IPLLEGKARSCFAMTEPQVASSDATNIEASIREEDSFYVINGHKWWITGILDPRCQLCVF
MGKTDPHAPRHRQQSVLLVPMDTPGIKIIRPLTVYGLEDAPGGHGEVRFEHVRVPKENMV
LGPGRGFEIAQGRLGPGRIHHCMRLIGFSERALALMKARVKSRLAFGKPLVEQGTVLADI
AQSRVEIEQARLLVLRAAHLMDLAGNKAAALDIAMIKMVAPSMASRVIDRAIQAFGAAGL
SSDYPLAQFFTWARALRFADGPDEVHRATVAKLELKHRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6JQN1	1.000	1.000	0.000	1059	1.000	1.000	Q6JQN1.pdb.gz	ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens OX=9606 GN=ACAD10 PE=1 SV=1
2	AFDB:Q8K370	0.690	0.685	0.000	1069	0.789	0.782	Q8K370.pdb.gz	ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus OX=10090 GN=Acad10 PE=1 SV=1
3	AFDB:Q8RWZ3	0.381	0.488	7.148E-73	824	0.362	0.465	Q8RWZ3.pdb.gz	IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana OX=3702 GN=IBR3 PE=1 SV=1
4	AFDB:Q709F0	0.369	0.498	1.031E-71	780	0.340	0.462	Q709F0.pdb.gz	ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 PE=1 SV=3
5	AFDB:B3DMA2	0.370	0.500	2.337E-71	779	0.350	0.476	B3DMA2.pdb.gz	ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus OX=10116 GN=Acad11 PE=1 SV=1
6	AFDB:D3Z7X0	0.389	0.733	3.061E-57	555	0.347	0.663	D3Z7X0.pdb.gz	D3Z7X0_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
7	AFDB:P96831	0.366	0.957	1.738E-38	403	0.204	0.536	P96831.pdb.gz	ACD2_MYCTU Probable acyl-CoA dehydrogenase FadE2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE2 PE=1 SV=4
8	AFDB:P96808	0.353	0.815	6.236E-29	447	0.138	0.327	P96808.pdb.gz	P96808_MYCTU Probable acyl-CoA dehydrogenase FadE1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE1 PE=1 SV=1
9	PDB:1jqiA	0.326	0.853	7.511E-23	384	0.105	0.289	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
10	AFDB:P08503	0.343	0.815	1.548E-22	421	0.104	0.261	P08503.pdb.gz	ACADM_RAT Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadm PE=1 SV=1
11	AFDB:Q9VSA3	0.341	0.820	2.594E-22	419	0.099	0.251	Q9VSA3.pdb.gz	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
12	PDB:1ivhA	0.330	0.854	8.561E-21	387	0.087	0.238	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
13	PDB:2a1tC	0.338	0.875	2.858E-20	388	0.096	0.263	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
14	PDB:6fahC	0.338	0.904	5.691E-20	379	0.094	0.264	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
15	PDB:1rx0A	0.339	0.896	2.162E-19	384	0.085	0.234	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
16	PDB:6af6A	0.326	0.852	5.115E-19	383	0.089	0.245	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
17	PDB:7s7gA	0.315	0.561	6.633E-17	571	0.094	0.175	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
18	PDB:2r0mA	0.328	0.850	9.361E-17	390	0.079	0.215	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
19	PDB:2ix6A	0.326	0.786	5.239E-16	416	0.077	0.197	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
20	PDB:4xvxB	0.304	0.805	7.393E-16	373	0.076	0.217	4xvxB.pdb.gz	A covalent adduct of MbtN, an acyl-ACP dehydrogenase from Mycobacterium tuberculosis, reveals an unusual acyl-binding pocket.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DMA2	0.0	701	779	0.352	0.479	ACD11_RAT Acyl-CoA dehydrogenase family member 11 OS=Rattus norvegicus OX=10116 GN=Acad11 PE=1 SV=1
2	D3Z7X0	0.0	765	555	0.347	0.663	D3Z7X0_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
3	Q6JQN1	0.0	2197	1059	1.000	1.000	ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens OX=9606 GN=ACAD10 PE=1 SV=1
4	Q709F0	0.0	701	780	0.348	0.473	ACD11_HUMAN Acyl-CoA dehydrogenase family member 11 OS=Homo sapiens OX=9606 GN=ACAD11 PE=1 SV=3
5	Q80XL6	0.0	697	779	0.355	0.483	ACD11_MOUSE Acyl-CoA dehydrogenase family member 11 OS=Mus musculus OX=10090 GN=Acad11 PE=1 SV=2
6	Q8K370	0.0	1803	1069	0.802	0.794	ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus OX=10090 GN=Acad10 PE=1 SV=1
7	Q8RWZ3	0.0	729	824	0.373	0.479	IBR3_ARATH Probable acyl-CoA dehydrogenase IBR3 OS=Arabidopsis thaliana OX=3702 GN=IBR3 PE=1 SV=1
8	D3Z2B3	4.40e-167	497	373	0.220	0.625	D3Z2B3_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
9	P96831	5.77e-138	423	407	0.205	0.533	ACD2_MYCTU Probable acyl-CoA dehydrogenase FadE2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE2 PE=1 SV=4
10	P96808	6.88e-68	237	447	0.129	0.306	P96808_MYCTU Probable acyl-CoA dehydrogenase FadE1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE1 PE=1 SV=1
11	O69727	1.83e-52	190	351	0.112	0.339	O69727_MYCTU Possible acyl-CoA dehydrogenase FadE36 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE36 PE=1 SV=1
12	F6RGT6	3.67e-37	140	182	0.062	0.363	F6RGT6_MOUSE Acyl-Coenzyme A dehydrogenase family, member 12 (Fragment) OS=Mus musculus OX=10090 GN=Acad12 PE=1 SV=1
13	Q07417	5.48e-37	146	412	0.097	0.250	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
14	P15651	6.61e-37	146	412	0.097	0.250	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
15	Q8BLZ1	8.16e-36	136	179	0.060	0.358	Q8BLZ1_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Acad12 PE=2 SV=1
16	E5KSD5	4.61e-35	141	412	0.103	0.265	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
17	P16219	4.61e-35	141	412	0.103	0.265	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
18	A0A0S2Z3P9	1.04e-32	134	432	0.103	0.252	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
19	P45954	1.04e-32	134	432	0.103	0.252	ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADSB PE=1 SV=1
20	P45952	1.95e-32	133	421	0.110	0.276	ACADM_MOUSE Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadm PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	1.5e-31	121.1	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	6.7e-09	47.5	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	6.1e-15	66.5	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	1e-08	47.2	Acyl-CoA dehydrogenase, N-terminal domain
5	PF01636 APH	7.5e-48	175.0	Phosphotransferase enzyme family
6	PF02958 EcKL	8.7	17.2	Ecdysteroid kinase-like family
7	PF13419 HAD_2	3.8e-07	41.9	Haloacid dehalogenase-like hydrolase
8	PF00702 Hydrolase	2.3e-05	36.4	haloacid dehalogenase-like hydrolase
9	PF01163 RIO1	25	15.9	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385927	0.940	Regulator of microtubule dynamics 1
2	9606.ENSP00000348775	0.916	Peroxisomal acyl-coenzyme A oxidase 3
3	9606.ENSP00000407761	0.904	Acyl-coenzyme A oxidase-like protein
4	9606.ENSP00000360569	0.887	Non-specific lipid-transfer protein
5	9606.ENSP00000382120	0.876	Apoptosis-inducing factor 3
6	9606.ENSP00000478931	0.876	Apoptosis-inducing factor 2
7	9606.ENSP00000369461	0.805	Enoyl-CoA delta isomerase 2, mitochondrial
8	9606.ENSP00000196371	0.795	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
9	9606.ENSP00000361914	0.795	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
10	9606.ENSP00000330442	0.784	Phospholipase B1, membrane-associated
11	9606.ENSP00000287156	0.770	Ubiquitin/ISG15-conjugating enzyme E2 L6
12	9606.ENSP00000400906	0.770	Ubiquitin-conjugating enzyme E2L 3
13	9606.ENSP00000485133	0.770	Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-live [...]
14	9606.ENSP00000377494	0.726	Transgelin-3
15	9606.ENSP00000254260	0.723	Rhophilin-2
16	9606.ENSP00000265562	0.723	Tyrosine-protein phosphatase non-receptor type 23
17	9606.ENSP00000289013	0.723	Rhophilin-1
18	9606.ENSP00000411825	0.723	Programmed cell death 6-interacting protein
19	9606.ENSP00000345292	0.715	Protein NDRG3
20	9606.ENSP00000377823	0.715	Protein NDRG4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003995	0.999	acyl-CoA dehydrogenase activity
GO:0005488	0.865	binding
GO:0005515	0.503	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006629	0.990	lipid metabolic process
GO:0044281	0.987	small molecule metabolic process
GO:0006635	0.980	fatty acid beta-oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0005759	0.624	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.999	Acting on the CH-CH group of donors.

[back to server]