StarFunc result for job id Q6K0P9

User Input

>input (492 residues)
MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDA
GLGKLIEFFKEIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACT
PSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQ
TSSSAPPNTSSTESLKPLANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFH
ATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSLLEVNEASSVSEAGPDQTFEV
PKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGE
CHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQ
HPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLS
SDTSTNRHPAVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6K0P9	1.000	1.000	2.251E-78	492	1.000	1.000	Q6K0P9.pdb.gz	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
2	AFDB:Q16666	0.397	0.250	8.661E-52	785	0.640	0.401	Q16666.pdb.gz	IF16_HUMAN Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3
3	AFDB:P41218	0.390	0.469	8.014E-45	407	0.435	0.526	P41218.pdb.gz	MNDA_HUMAN Myeloid cell nuclear differentiation antigen OS=Homo sapiens OX=9606 GN=MNDA PE=1 SV=1
4	AFDB:Q8CGE8	0.422	0.507	2.421E-40	404	0.358	0.436	Q8CGE8.pdb.gz	IFI5A_MOUSE Interferon-activable protein 205-A OS=Mus musculus OX=10090 GN=Ifi205a PE=2 SV=1
5	AFDB:P0DOV2	0.398	0.319	5.352E-40	619	0.398	0.317	P0DOV2.pdb.gz	IFI4_MOUSE Interferon-activable protein 204 OS=Mus musculus OX=10090 GN=Ifi204 PE=1 SV=1
6	AFDB:D0QMC3	0.454	0.422	5.664E-40	538	0.419	0.383	D0QMC3.pdb.gz	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
7	AFDB:O35368	0.375	0.450	1.345E-33	408	0.331	0.400	O35368.pdb.gz	IFI3_MOUSE Interferon-activable protein 203 OS=Mus musculus OX=10090 GN=Ifi203 PE=1 SV=1
8	AFDB:Q8BV49	0.378	0.441	1.345E-33	420	0.315	0.369	Q8BV49.pdb.gz	IFIX_MOUSE Pyrin and HIN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyhin1 PE=1 SV=1
9	PDB:5h7qA	0.189	0.198	2.511E-7	469	0.108	0.113	5h7qA.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
10	PDB:2i0qA	0.207	0.218	3.951E-7	461	0.063	0.067	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
11	PDB:6w6wA	0.218	0.133	4.036E-6	905	0.041	0.022	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
12	PDB:8d0bA	0.237	0.121	1.254E-5	1116	0.045	0.020	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
13	PDB:7qxbP	0.200	0.340	1.865E-5	251	0.045	0.088	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
14	PDB:7uy7A	0.123	0.112	5.793E-5	552	0.055	0.049	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
15	PDB:7uy5I	0.134	0.127	1.701E-4	528	0.061	0.057	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
16	PDB:7u5cE	0.210	0.105	4.458E-4	1147	0.041	0.017	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
17	PDB:4owwB	0.153	0.592	1.168E-3	107	0.035	0.159	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
18	PDB:2pi2A	0.136	0.485	2.734E-3	129	0.030	0.116	2pi2A.pdb.gz
19	AFDB:Q5A1E0	0.072	0.035	3.657E-2	1308	0.120	0.045	Q5A1E0.pdb.gz	IFF5_CANAL Cell wall protein IFF5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IFF5 PE=1 SV=1
20	AFDB:Q8N3J3	0.134	0.104	6.445E-2	647	0.128	0.097	Q8N3J3.pdb.gz	HROB_HUMAN Homologous recombination OB-fold protein OS=Homo sapiens OX=9606 GN=HROB PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16666	0.0	597	785	0.626	0.392	IF16_HUMAN Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3
2	Q6K0P9	0.0	1010	492	1.000	1.000	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
3	P41218	1.95e-130	386	407	0.435	0.526	MNDA_HUMAN Myeloid cell nuclear differentiation antigen OS=Homo sapiens OX=9606 GN=MNDA PE=1 SV=1
4	Q5VUU6	1.95e-130	386	407	0.435	0.526	Q5VUU6_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=MNDA PE=2 SV=1
5	P0DOV2	9.79e-110	340	619	0.402	0.320	IFI4_MOUSE Interferon-activable protein 204 OS=Mus musculus OX=10090 GN=Ifi204 PE=1 SV=1
6	X6RHR0	2.28e-102	305	150	0.305	1.000	X6RHR0_HUMAN Pyrin and HIN domain family member 1 (Fragment) OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
7	Q8CGE8	4.82e-100	308	404	0.362	0.441	IFI5A_MOUSE Interferon-activable protein 205-A OS=Mus musculus OX=10090 GN=Ifi205a PE=2 SV=1
8	Q05CU9	3.63e-86	269	310	0.317	0.503	Q05CU9_HUMAN MNDA protein (Fragment) OS=Homo sapiens OX=9606 GN=MNDA PE=2 SV=1
9	Q8BV49	4.98e-71	233	420	0.331	0.388	IFIX_MOUSE Pyrin and HIN domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pyhin1 PE=1 SV=1
10	D0QMC3	7.77e-71	236	538	0.262	0.240	MNDAL_MOUSE Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus OX=10090 GN=Mndal PE=1 SV=1
11	O35368	4.09e-65	218	408	0.319	0.385	IFI3_MOUSE Interferon-activable protein 203 OS=Mus musculus OX=10090 GN=Ifi203 PE=1 SV=1
12	O14862	1.75e-45	164	343	0.254	0.364	AIM2_HUMAN Interferon-inducible protein AIM2 OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
13	Q9R002	5.07e-45	165	445	0.181	0.200	IFI2_MOUSE Interferon-activable protein 202 OS=Mus musculus OX=10090 GN=Ifi202 PE=1 SV=3
14	Q5T3W0	1.17e-34	129	167	0.144	0.425	Q5T3W0_HUMAN Absent in melanoma 2 (Fragment) OS=Homo sapiens OX=9606 GN=AIM2 PE=1 SV=1
15	Q91VJ1	7.73e-30	121	354	0.189	0.263	AIM2_MOUSE Interferon-inducible protein AIM2 OS=Mus musculus OX=10090 GN=Aim2 PE=1 SV=2
16	M9PB32	0.28	36.6	19560	0.063	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PBZ4	0.30	36.6	18014	0.063	0.002	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC41	0.30	36.6	22743	0.063	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PB30	0.32	36.2	22949	0.063	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
20	M9PBZ0	0.32	36.2	22830	0.063	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02760 HIN	8e-69	242.2	HIN-200/IF120x domain
2	PF02758 PYRIN	1.8e-09	48.9	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357122

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364037	0.702	Testis-expressed protein 10
2	9606.ENSP00000219596	0.692	Pyrin
3	9606.ENSP00000393183	0.685	DDB1- and CUL4-associated factor 1
4	9606.ENSP00000258149	0.606	E3 ubiquitin-protein ligase Mdm2
5	9606.ENSP00000363944	0.601	Ribosomal biogenesis protein LAS1L
6	9606.ENSP00000410446	0.577	Tripartite motif-containing protein 26
7	9606.ENSP00000314029	0.570	Sentrin-specific protease 3
8	9606.ENSP00000415049	0.565	Gasdermin-B
9	9606.ENSP00000377724	0.563	ORM1-like protein 3
10	9606.ENSP00000479816	0.561	DENN domain-containing protein 1B
11	9606.ENSP00000252542	0.559	Scaffold attachment factor B2
12	9606.ENSP00000353863	0.559	Zinc finger protein 148
13	9606.ENSP00000301396	0.557	Proline-, glutamic acid- and leucine-rich protein 1
14	9606.ENSP00000312625	0.557	Heterochromatin protein 1-binding protein 3
15	9606.ENSP00000362441	0.554	Transcriptional regulator ATRX
16	9606.ENSP00000372221	0.549	Serpin B5
17	9606.ENSP00000467423	0.545	Scaffold attachment factor B1
18	9606.ENSP00000342434	0.515	Tyrosine-protein kinase BAZ1B
19	9606.ENSP00000303434	0.509	Ubiquitin carboxyl-terminal hydrolase 38
20	9606.ENSP00000368678	0.507	Agrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.997	ubiquitin protein ligase binding
GO:1901363	0.968	heterocyclic compound binding
GO:0097159	0.968	organic cyclic compound binding
GO:0003676	0.963	nucleic acid binding
GO:0003677	0.915	DNA binding
GO:0003690	0.900	double-stranded DNA binding
GO:0042802	0.550	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0048522	0.992	positive regulation of cellular process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0009987	0.990	cellular process
GO:0050896	0.987	response to stimulus
GO:0010604	0.985	positive regulation of macromolecule metabolic process
GO:0051173	0.982	positive regulation of nitrogen compound metabolic process
GO:0051246	0.970	regulation of protein metabolic process
GO:0051716	0.968	cellular response to stimulus
GO:0019219	0.964	regulation of nucleobase-containing compound metabolic process
GO:0048583	0.963	regulation of response to stimulus
GO:0010468	0.954	regulation of gene expression
GO:0051247	0.949	positive regulation of protein metabolic process
GO:0051252	0.924	regulation of RNA metabolic process
GO:0006355	0.896	regulation of DNA-templated transcription
GO:0031325	0.893	positive regulation of cellular metabolic process
GO:0045935	0.818	positive regulation of nucleobase-containing compound metabolic process
GO:0045862	0.815	positive regulation of proteolysis
GO:0009894	0.776	regulation of catabolic process
GO:0042221	0.773	response to chemical
GO:0031647	0.764	regulation of protein stability
GO:0065009	0.760	regulation of molecular function
GO:0071310	0.759	cellular response to organic substance
GO:0080134	0.741	regulation of response to stress
GO:0048584	0.738	positive regulation of response to stimulus
GO:0031329	0.724	regulation of cellular catabolic process
GO:1903050	0.722	regulation of proteolysis involved in protein catabolic process
GO:0071345	0.668	cellular response to cytokine stimulus
GO:2000058	0.649	regulation of ubiquitin-dependent protein catabolic process
GO:0048519	0.641	negative regulation of biological process
GO:1903052	0.632	positive regulation of proteolysis involved in protein catabolic process
GO:0060341	0.566	regulation of cellular localization
GO:0048523	0.563	negative regulation of cellular process
GO:0031648	0.550	protein destabilization
GO:0032880	0.549	regulation of protein localization
GO:1900180	0.458	regulation of protein localization to nucleus
GO:0009966	0.449	regulation of signal transduction
GO:0031331	0.441	positive regulation of cellular catabolic process
GO:0051098	0.435	regulation of binding
GO:0044093	0.423	positive regulation of molecular function
GO:1902531	0.369	regulation of intracellular signal transduction
GO:0009892	0.368	negative regulation of metabolic process
GO:0051172	0.350	negative regulation of nitrogen compound metabolic process
GO:2000060	0.334	positive regulation of ubiquitin-dependent protein catabolic process
GO:2001020	0.333	regulation of response to DNA damage stimulus
GO:1901796	0.333	regulation of signal transduction by p53 class mediator
GO:0051254	0.332	positive regulation of RNA metabolic process
GO:0010557	0.331	positive regulation of macromolecule biosynthetic process
GO:0031328	0.323	positive regulation of cellular biosynthetic process
GO:0071704	0.322	organic substance metabolic process
GO:1900182	0.321	positive regulation of protein localization to nucleus
GO:0051099	0.306	positive regulation of binding
GO:0010605	0.306	negative regulation of macromolecule metabolic process
GO:0006950	0.304	response to stress
GO:2001022	0.304	positive regulation of response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0032991	0.973	protein-containing complex
GO:0005737	0.934	cytoplasm
GO:0005829	0.829	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]