StarFunc result for job id Q6KB66

User Input

>input (452 residues)
MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTV
NPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQG
QDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTD
MEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGM
DSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIA
DLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMA
RQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6KB66	1.000	1.000	1.048E-54	452	1.000	1.000	Q6KB66.pdb.gz	K2C80_HUMAN Keratin, type II cytoskeletal 80 OS=Homo sapiens OX=9606 GN=KRT80 PE=1 SV=2
2	AFDB:P11679	0.592	0.551	1.097E-19	490	0.405	0.373	P11679.pdb.gz	K2C8_MOUSE Keratin, type II cytoskeletal 8 OS=Mus musculus OX=10090 GN=Krt8 PE=1 SV=4
3	AFDB:Q8BGZ7	0.326	0.277	1.357E-18	551	0.412	0.338	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
4	AFDB:O95678	0.334	0.278	1.459E-18	551	0.418	0.343	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
5	AFDB:P19013	0.533	0.475	2.992E-18	520	0.398	0.346	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
6	AFDB:A0A1D5PXP0	0.365	0.325	3.215E-18	522	0.405	0.351	A0A1D5PXP0.pdb.gz
7	AFDB:Q9NSB4	0.354	0.314	6.140E-18	513	0.385	0.339	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
8	AFDB:P08729	0.374	0.362	1.015E-17	469	0.414	0.399	P08729.pdb.gz	K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5
9	AFDB:Q9DCV7	0.361	0.358	1.172E-17	457	0.396	0.392	Q9DCV7.pdb.gz	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
10	AFDB:Q14CN4	0.535	0.484	2.239E-17	511	0.381	0.337	Q14CN4.pdb.gz	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
11	PDB:7r72w	0.083	0.192	8.945	189	0.049	0.116	7r72w.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6KB66	0.0	919	452	1.000	1.000	K2C80_HUMAN Keratin, type II cytoskeletal 80 OS=Homo sapiens OX=9606 GN=KRT80 PE=1 SV=2
2	O95678	5.10e-109	335	551	0.374	0.307	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
3	Q6P3K5	2.47e-108	333	553	0.374	0.306	Q6P3K5_DANRE Krt5 protein OS=Danio rerio OX=7955 GN=krt5 PE=2 SV=1
4	F1QV31	4.52e-108	333	566	0.374	0.299	F1QV31_DANRE Keratin 5 OS=Danio rerio OX=7955 GN=ckii PE=1 SV=1
5	Q8BGZ7	2.68e-107	330	551	0.376	0.309	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
6	P11679	2.93e-107	328	490	0.361	0.333	K2C8_MOUSE Keratin, type II cytoskeletal 8 OS=Mus musculus OX=10090 GN=Krt8 PE=1 SV=4
7	P05787	2.25e-106	325	483	0.374	0.350	K2C8_HUMAN Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7
8	Q9DCV7	1.93e-105	322	457	0.394	0.389	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
9	P13647	6.12e-105	325	590	0.358	0.275	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
10	Q6P6Q2	3.61e-104	323	576	0.358	0.281	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
11	Q6PVZ5	5.45e-104	323	599	0.367	0.277	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
12	Q922U2	2.20e-103	321	580	0.356	0.278	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
13	P50446	6.77e-103	319	553	0.361	0.295	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
14	Q10758	6.94e-103	317	483	0.354	0.331	K2C8_RAT Keratin, type II cytoskeletal 8 OS=Rattus norvegicus OX=10116 GN=Krt8 PE=1 SV=3
15	P02538	1.81e-102	318	564	0.363	0.291	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
16	P19013	2.34e-102	317	520	0.361	0.313	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
17	P48668	3.71e-102	317	564	0.363	0.291	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
18	P04259	4.36e-102	317	564	0.361	0.289	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
19	Q9Z331	5.34e-102	317	562	0.361	0.290	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
20	Q5XKE5	6.06e-101	313	535	0.372	0.314	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08647 BRE1	3.7e+02	12.6	BRE1 E3 ubiquitin ligase
2	PF07323 DUF1465	2.6e+02	12.9	Protein of unknown function (DUF1465)
3	PF00038 Filament	4.4e-81	284.5	Intermediate filament protein
4	PF16208 Keratin_2_head	0.026	26.1	Keratin type II head
5	PF12595 Rhomboid_SP	1.5e+02	13.4	Rhomboid serine protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360922	0.758	Double-stranded RNA-binding protein Staufen homolog 1
2	9606.ENSP00000369349	0.643	Keratin, type II cuticular Hb1
3	9606.ENSP00000444533	0.589	Keratin, type II cuticular Hb6
4	9606.ENSP00000470142	0.585	Regulator of nonsense transcripts 1
5	9606.ENSP00000329243	0.541	Keratin, type II cytoskeletal 7
6	9606.ENSP00000293670	0.529	Keratin, type II cuticular Hb3
7	9606.ENSP00000307240	0.528	Keratin, type II cytoskeletal 74
8	9606.ENSP00000252245	0.526	Keratin, type II cytoskeletal 75
9	9606.ENSP00000257901	0.526	Keratin, type II cuticular Hb5
10	9606.ENSP00000257951	0.525	Keratin, type II cuticular Hb4
11	9606.ENSP00000334866	0.525	Keratin-associated protein 15-1
12	9606.ENSP00000293745	0.524	Keratin, type II cytoskeletal 72
13	9606.ENSP00000257974	0.520	Keratin, type II cuticular Hb2
14	9606.ENSP00000307014	0.520	Keratin, type II cytoskeletal 73
15	9606.ENSP00000375430	0.517	Keratin-associated protein 3-1
16	9606.ENSP00000365465	0.514	Corneodesmosin
17	9606.ENSP00000267119	0.512	Keratin, type II cytoskeletal 71

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0032502	0.667	developmental process
GO:0048856	0.660	anatomical structure development
GO:0045103	0.460	intermediate filament-based process
GO:0071840	0.365	cellular component organization or biogenesis
GO:0050789	0.341	regulation of biological process
GO:0016043	0.341	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005829	0.988	cytosol
GO:0045111	0.988	intermediate filament cytoskeleton
GO:0099081	0.965	supramolecular polymer
GO:0099513	0.899	polymeric cytoskeletal fiber
GO:0005882	0.885	intermediate filament
GO:0005576	0.721	extracellular region
GO:0005615	0.451	extracellular space
GO:0043230	0.390	extracellular organelle
GO:0043227	0.383	membrane-bounded organelle
GO:0031982	0.363	vesicle
GO:0070062	0.315	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]