StarFunc result for job id Q6KC79

User Input

>input (1400 residues)
MNGDMPHVPITTLAGIASLTDLLNQLPLPSPLPATTTKSLLFNARIAEEVNCLLACRDDN
LVSQLVHSLNQVSTDHIELKDNLGSDDPEGDIPVLLQAVLARSPNVFREKSMQNRYVQSG
MMMSQYKLSQNSMHSSPASSNYQQTTISHSPSSRFVPPQTSSGNRFMPQQNSPVPSPYAP
QSPAGYMPYSHPSSYTTHPQMQQASVSSPIVAGGLRNIHDNKVSGPLSGNSANHHADNPR
HGSSEDYLHMVHRLSSDDGDSSTMRNAASFPLRSPQPVCSPAGSEGTPKGSRPPLILQSQ
SLPCSSPRDVPPDILLDSPERKQKKQKKMKLGKDEKEQSEKAAMYDIISSPSKDSTKLTL
RLSRVRSSDMDQQEDMISGVENSNVSENDIPFNVQYPGQTSKTPITPQDINRPLNAAQCL
SQQEQTAFLPANQVPVLQQNTSVAAKQPQTSVVQNQQQISQQGPIYDEVELDALAEIERI
ERESAIERERFSKEVQDKDKPLKKRKQDSYPQEAGGATGGNRPASQETGSTGNGSRPALM
VSIDLHQAGRVDSQASITQDSDSIKKPEEIKQCNDAPVSVLQEDIVGSLKSTPENHPETP
KKKSDPELSKSEMKQSESRLAESKPNENRLVETKSSENKLETKVETQTEELKQNESRTTE
CKQNESTIVEPKQNENRLSDTKPNDNKQNNGRSETTKSRPETPKQKGESRPETPKQKSDG
HPETPKQKGDGRPETPKQKGESRPETPKQKNEGRPETPKHRHDNRRDSGKPSTEKKPEVS
KHKQDTKSDSPRLKSERAEALKQRPDGRSVSESLRRDHDNKQKSDDRGESERHRGDQSRV
RRPETLRSSSRNEHGIKSDSSKTDKLERKHRHESGDSRERPSSGEQKSRPDSPRVKQGDS
NKSRSDKLGFKSPTSKDDKRTEGNKSKVDTNKAHPDNKAEFPSYLLGGRSGALKNFVIPK
IKRDKDGNVTQETKKMEMKGEPKDKVEKIGLVEDLNKGAKPVVVLQKLSLDDVQKLIKDR
EDKSRSSLKPIKNKPSKSNKGSIDQSVLKELPPELLAEIESTMPLCERVKMNKRKRSTVN
EKPKYAEISSDEDNDSDEAFESSRKRHKKDDDKAWEYEERDRRSSGDHRRSGHSHEGRRS
SGGGRYRNRSPSDSDMEDYSPPPSLSEVARKMKKKEKQKKRKAYEPKLTPEEMMDSSTFK
RFTASIENILDNLEDMDFTAFGDDDEIPQELLLGKHQLNELGSESAKIKAMGIMDKLSTD
KTVKVLNILEKNIQDGSKLSTLLNHNNDTEEEERLWRDLIMERVTKSADACLTTINIMTS
PNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCSTHKQ
RVIVMLYNKVCDIVSSLSEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9W517	0.051	0.045	1.067E-4	1741	0.139	0.112	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
2	AFDB:Q1W617	0.057	0.055	1.858E-4	1475	0.140	0.133	Q1W617.pdb.gz	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
3	AFDB:Q76E23	0.072	0.062	2.162E-4	1727	0.142	0.115	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
4	AFDB:Q55DL8	0.083	0.077	2.926E-4	1574	0.119	0.105	Q55DL8.pdb.gz	Q55DL8_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcT PE=4 SV=1
5	AFDB:A8DZ29	0.051	0.043	4.846E-4	1919	0.139	0.101	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
6	AFDB:F4IZK5	0.063	0.062	5.930E-4	1403	0.142	0.142	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
7	AFDB:Q9GRZ3	0.052	0.046	8.441E-4	1641	0.129	0.110	Q9GRZ3.pdb.gz	DPY21_CAEEL Lysine-specific demethylase 9 OS=Caenorhabditis elegans OX=6239 GN=dpy-21 PE=1 SV=1
8	AFDB:M9PGK7	0.056	0.040	1.143E-3	2272	0.150	0.092	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
9	AFDB:Q9VQI9	0.073	0.064	1.990E-3	1673	0.146	0.123	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
10	AFDB:Q9W539	0.056	0.054	2.833E-3	1518	0.136	0.126	Q9W539.pdb.gz	HR4_DROME Hormone receptor 4 OS=Drosophila melanogaster OX=7227 GN=Hr4 PE=1 SV=4
11	PDB:1keyB	0.064	0.297	1.658E-1	221	0.016	0.104	1keyB.pdb.gz
12	PDB:3c98B	0.055	0.212	2.611E-1	230	0.022	0.135	3c98B.pdb.gz
13	PDB:7a9wA	0.063	0.137	2.611E-1	513	0.014	0.037	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
14	PDB:7kzpS	0.054	0.059	2.746E-1	1250	0.019	0.022	7kzpS.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:1oyzA	0.035	0.116	3.909E-1	273	0.021	0.106	1oyzA.pdb.gz
16	PDB:4f7rD	0.046	0.156	4.548E-1	238	0.013	0.076	4f7rD.pdb.gz
17	PDB:2br9A	0.043	0.173	5.565E-1	230	0.022	0.135	2br9A.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
18	PDB:6jhoA	0.034	0.152	5.565E-1	200	0.014	0.100	6jhoA.pdb.gz
19	PDB:2b7mB	0.058	0.121	5.853E-1	523	0.019	0.050	2b7mB.pdb.gz
20	PDB:7anwA	0.050	0.091	6.809E-1	645	0.014	0.031	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UJS4	0.0	2873	2649	1.000	0.529	A0A590UJS4_HUMAN Nipped-B protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=1
2	F1QBY1	0.0	631	2876	0.258	0.126	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
3	Q1XG42	0.0	1045	2949	0.412	0.196	Q1XG42_XENLA Nipped-B protein OS=Xenopus laevis OX=8355 GN=nipbl.L PE=2 SV=1
4	Q1XG44	0.0	1912	2932	0.740	0.353	Q1XG44_XENLA Nipped-B protein OS=Xenopus laevis OX=8355 GN=nipbl.S PE=2 SV=1
5	Q6KC79	0.0	2876	2804	1.000	0.499	NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2
6	Q6KCD5	0.0	2637	2798	0.948	0.474	NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus OX=10090 GN=Nipbl PE=1 SV=1
7	F5HSE3	8.39e-170	564	2381	0.225	0.132	NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1
8	Q7PLI2	8.40e-12	72.8	2077	0.033	0.022	NIPB_DROME Nipped-B protein OS=Drosophila melanogaster OX=7227 GN=Nipped-B PE=1 SV=3
9	Q95XZ5	6.50e-10	66.6	2176	0.043	0.028	NIPBL_CAEEL Nipped-B-like protein scc-2 OS=Caenorhabditis elegans OX=6239 GN=scc-2 PE=1 SV=3
10	A5HEI1	0.047	40.8	1846	0.025	0.019	SCC2_ARATH Sister chromatid cohesion protein SCC2 OS=Arabidopsis thaliana OX=3702 GN=SCC2 PE=1 SV=1
11	Q9LXB8	0.080	39.7	370	0.032	0.122	PLPK1_ARATH Protein PELPK1 OS=Arabidopsis thaliana OX=3702 GN=PELPK1 PE=2 SV=1
12	O74792	0.44	37.4	515	0.019	0.052	SNF59_SCHPO SWI/SNF global transcription activator complex subunit snf59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf59 PE=1 SV=1
13	Q28298	0.82	36.6	1534	0.036	0.033	RRBP1_CANLF Ribosome-binding protein 1 OS=Canis lupus familiaris OX=9615 GN=RRBP1 PE=2 SV=1
14	F1MEW3	3.2	34.7	2008	0.022	0.015	F1MEW3_BOVIN Microtubule-associated protein OS=Bos taurus OX=9913 GN=MAP2 PE=4 SV=2
15	P17535	4.0	33.9	347	0.019	0.075	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3
16	B4UN33	6.6	33.9	1423	0.029	0.028	B4UN33_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00170g PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282516

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262815	0.999	MAU2 chromatid cohesion factor homolog
2	9606.ENSP00000297338	0.999	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000323421	0.999	Structural maintenance of chromosomes protein 1A
4	9606.ENSP00000354720	0.999	Structural maintenance of chromosomes protein 3
5	9606.ENSP00000372689	0.996	Cohesin subunit SA-1
6	9606.ENSP00000303427	0.995	Sister chromatid cohesion protein PDS5 homolog A
7	9606.ENSP00000313851	0.990	Sister chromatid cohesion protein PDS5 homolog B
8	9606.ENSP00000218089	0.987	Cohesin subunit SA-2
9	9606.ENSP00000298767	0.973	Wings apart-like protein homolog
10	9606.ENSP00000354957	0.963	Structural maintenance of chromosomes protein 5
11	9606.ENSP00000350036	0.951	Structural maintenance of chromosomes protein 1B
12	9606.ENSP00000477973	0.945	Cohesin subunit SA-3
13	9606.ENSP00000386414	0.944	Double-strand-break repair protein rad21-like protein 1
14	9606.ENSP00000307208	0.942	Nucleosome-remodeling factor subunit BPTF
15	9606.ENSP00000257934	0.941	Separin
16	9606.ENSP00000482546	0.938	Meiotic recombination protein REC8 homolog
17	9606.ENSP00000386759	0.935	Histone-lysine N-methyltransferase SETD2
18	9606.ENSP00000349961	0.917	Structural maintenance of chromosomes protein 4
19	9606.ENSP00000269214	0.913	N-acetyltransferase ESCO1
20	9606.ENSP00000306999	0.906	N-acetyltransferase ESCO2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140097	0.867	catalytic activity, acting on DNA
GO:0008094	0.522	ATP-dependent activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0080090	0.972	regulation of primary metabolic process
GO:0019219	0.959	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0009889	0.951	regulation of biosynthetic process
GO:0032502	0.943	developmental process
GO:0010556	0.941	regulation of macromolecule biosynthetic process
GO:0031326	0.941	regulation of cellular biosynthetic process
GO:2001141	0.931	regulation of RNA biosynthetic process
GO:0010468	0.923	regulation of gene expression
GO:0009987	0.882	cellular process
GO:0009790	0.804	embryo development
GO:0009887	0.787	animal organ morphogenesis
GO:0048568	0.772	embryonic organ development
GO:0006355	0.565	regulation of DNA-templated transcription
GO:0071840	0.540	cellular component organization or biogenesis
GO:0048518	0.537	positive regulation of biological process
GO:0016043	0.520	cellular component organization
GO:0006357	0.520	regulation of transcription by RNA polymerase II
GO:0010604	0.410	positive regulation of macromolecule metabolic process
GO:0051173	0.397	positive regulation of nitrogen compound metabolic process
GO:0007049	0.386	cell cycle
GO:0048731	0.381	system development
GO:0022402	0.373	cell cycle process
GO:0006996	0.337	organelle organization
GO:0000278	0.325	mitotic cell cycle
GO:1903047	0.324	mitotic cell cycle process
GO:0051276	0.319	chromosome organization
GO:0048598	0.303	embryonic morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.989	cytoplasm
GO:0032991	0.987	protein-containing complex
GO:0005829	0.981	cytosol
GO:0043228	0.613	non-membrane-bounded organelle
GO:0043232	0.567	intracellular non-membrane-bounded organelle
GO:0140513	0.540	nuclear protein-containing complex
GO:0005694	0.456	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]