StarFunc result for job id Q6KF10

User Input

>input (455 residues)
MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDA
GREGQEPQPRPQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQS
SKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPP
AGPLHVQLFPCLSPLLLDARTLDPQGAPPAGWEVFDVWQGLRHQPWKQLCLELRAAWGEL
DAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFAEMREQLGSA
EAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSKKPLH
VNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC
VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6KF10	1.000	1.000	1.881E-84	455	1.000	1.000	Q6KF10.pdb.gz	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
2	AFDB:P43028	0.760	0.762	9.728E-72	454	0.877	0.879	P43028.pdb.gz	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
3	AFDB:P85857	0.656	0.736	1.071E-46	404	0.554	0.624	P85857.pdb.gz	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
4	AFDB:Q7Z4P5	0.626	0.633	1.363E-41	450	0.451	0.456	Q7Z4P5.pdb.gz	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2
5	AFDB:P43029	0.620	0.612	4.880E-41	461	0.426	0.421	P43029.pdb.gz	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
6	AFDB:P43026	0.615	0.560	1.088E-39	501	0.451	0.409	P43026.pdb.gz	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
7	AFDB:P34821	0.562	0.634	7.235E-28	399	0.246	0.281	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
8	AFDB:P34820	0.501	0.562	1.662E-27	402	0.248	0.281	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
9	AFDB:F1NUT2	0.565	0.554	1.157E-26	465	0.264	0.258	F1NUT2.pdb.gz
10	AFDB:P07713	0.508	0.401	1.614E-26	588	0.251	0.194	P07713.pdb.gz	DECA_DROME Protein decapentaplegic OS=Drosophila melanogaster OX=7227 GN=dpp PE=1 SV=2
11	PDB:5hlyA	0.249	0.355	8.327E-14	299	0.187	0.284	5hlyA.pdb.gz
12	PDB:3rjrC	0.236	0.300	2.590E-12	343	0.171	0.227	3rjrC.pdb.gz
13	PDB:5vqfB	0.267	0.364	8.298E-12	320	0.160	0.228	5vqfB.pdb.gz
14	PDB:5ntuA	0.213	0.296	2.380E-11	308	0.156	0.231	5ntuA.pdb.gz
15	PDB:5ffoG	0.261	0.376	1.063E-10	297	0.163	0.249	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
16	PDB:5nxsA	0.189	0.270	2.311E-10	290	0.156	0.245	5nxsA.pdb.gz
17	PDB:6umxA	0.210	0.320	1.219E-9	279	0.147	0.240	6umxA.pdb.gz
18	PDB:7y1rB	0.239	0.333	1.289E-9	308	0.154	0.227	7y1rB.pdb.gz
19	PDB:5nxsB	0.156	0.278	2.426E-6	251	0.134	0.243	5nxsB.pdb.gz
20	PDB:6q2sA	0.142	0.526	4.971E-4	98	0.048	0.224	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43028	0.0	772	454	0.877	0.879	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
2	Q6KF10	0.0	928	455	1.000	1.000	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
3	P85857	1.20e-157	454	404	0.569	0.641	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
4	P43027	3.50e-114	346	495	0.426	0.392	GDF5_MOUSE Growth/differentiation factor 5 OS=Mus musculus OX=10090 GN=Gdf5 PE=1 SV=2
5	M0RAY4	4.16e-114	346	495	0.426	0.392	M0RAY4_RAT Growth differentiation factor 5 OS=Rattus norvegicus OX=10116 GN=Gdf5 PE=3 SV=1
6	P43026	3.23e-113	344	501	0.429	0.389	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
7	Q7Z4P5	2.30e-87	276	450	0.409	0.413	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2
8	P43029	3.67e-78	252	461	0.413	0.408	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
9	Q8UVQ2	1.09e-47	170	391	0.279	0.325	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
10	Q4AEG6	2.82e-43	159	421	0.290	0.314	BMP10_RAT Bone morphogenetic protein 10 OS=Rattus norvegicus OX=10116 GN=Bmp10 PE=2 SV=1
11	Q70GM8	3.07e-43	158	383	0.277	0.329	Q70GM8_CHICK Bone morphogenetic protein-10 (Fragment) OS=Gallus gallus OX=9031 GN=BMP-10 PE=2 SV=1
12	Q90752	1.06e-42	157	405	0.284	0.319	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
13	P49001	1.27e-42	157	393	0.259	0.300	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
14	O57574	3.70e-42	155	400	0.281	0.320	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
15	D4A7P9	3.90e-42	157	454	0.218	0.218	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
16	Q7T288	6.56e-42	156	446	0.220	0.224	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
17	P49003	9.05e-42	155	452	0.218	0.219	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
18	Q9R229	9.87e-42	155	421	0.286	0.309	BMP10_MOUSE Bone morphogenetic protein 10 OS=Mus musculus OX=10090 GN=Bmp10 PE=1 SV=2
19	A5HMF9	2.88e-41	153	404	0.251	0.282	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
20	A5HMF8	5.26e-41	152	404	0.259	0.292	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	2.1e-07	42.5	TGF-beta propeptide
2	PF00019 TGF_beta	1.1e-30	117.9	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287020

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401907	0.959	Bone morphogenetic protein receptor type-1B
2	9606.ENSP00000361107	0.939	Bone morphogenetic protein receptor type-1A
3	9606.ENSP00000363708	0.938	Bone morphogenetic protein receptor type-2
4	9606.ENSP00000340361	0.894	Activin receptor type-2B
5	9606.ENSP00000241416	0.878	Activin receptor type-2A
6	9606.ENSP00000204604	0.824	Chordin
7	9606.ENSP00000328181	0.784	Noggin
8	9606.ENSP00000257863	0.734	Anti-Muellerian hormone type-2 receptor
9	9606.ENSP00000318650	0.723	Gremlin-2
10	9606.ENSP00000478319	0.712	Gremlin-1
11	9606.ENSP00000243347	0.681	Tumor necrosis factor-inducible gene 6 protein
12	9606.ENSP00000289749	0.663	Neuroblastoma suppressor of tumorigenicity 1
13	9606.ENSP00000417898	0.640	Glycodelin
14	9606.ENSP00000297405	0.609	CUB and sushi domain-containing protein 3
15	9606.ENSP00000393795	0.589	Zinc finger protein 512B
16	9606.ENSP00000362122	0.577	Tenomodulin
17	9606.ENSP00000476384	0.577	Basic helix-loop-helix transcription factor scleraxis
18	9606.ENSP00000234392	0.575	Ventral anterior homeobox 2
19	9606.ENSP00000228641	0.562	Myogenic factor 6
20	9606.ENSP00000265340	0.559	Pituitary homeobox 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.979	signaling receptor binding
GO:0140677	0.920	molecular function activator activity
GO:0048018	0.900	receptor ligand activity
GO:0042802	0.879	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0032501	0.986	multicellular organismal process
GO:0023052	0.986	signaling
GO:0007154	0.986	cell communication
GO:0048856	0.985	anatomical structure development
GO:0048518	0.980	positive regulation of biological process
GO:0007166	0.979	cell surface receptor signaling pathway
GO:0007178	0.971	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007275	0.970	multicellular organism development
GO:0048522	0.969	positive regulation of cellular process
GO:0070848	0.966	response to growth factor
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0030509	0.946	BMP signaling pathway
GO:0050793	0.930	regulation of developmental process
GO:0090092	0.928	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048869	0.924	cellular developmental process
GO:0019219	0.917	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.909	regulation of macromolecule biosynthetic process
GO:0031326	0.909	regulation of cellular biosynthetic process
GO:0060395	0.902	SMAD protein signal transduction
GO:0051252	0.901	regulation of RNA metabolic process
GO:0060393	0.901	regulation of pathway-restricted SMAD protein phosphorylation
GO:0048513	0.893	animal organ development
GO:0051094	0.892	positive regulation of developmental process
GO:0048731	0.890	system development
GO:2001141	0.876	regulation of RNA biosynthetic process
GO:0090100	0.875	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0044238	0.868	primary metabolic process
GO:0071704	0.863	organic substance metabolic process
GO:0045595	0.857	regulation of cell differentiation
GO:0045597	0.842	positive regulation of cell differentiation
GO:0044237	0.835	cellular metabolic process
GO:0010468	0.816	regulation of gene expression
GO:0006807	0.786	nitrogen compound metabolic process
GO:0009893	0.761	positive regulation of metabolic process
GO:0031401	0.742	positive regulation of protein modification process
GO:0006355	0.732	regulation of DNA-templated transcription
GO:0051239	0.726	regulation of multicellular organismal process
GO:0043170	0.723	macromolecule metabolic process
GO:0030154	0.719	cell differentiation
GO:0031325	0.709	positive regulation of cellular metabolic process
GO:0051240	0.705	positive regulation of multicellular organismal process
GO:0048519	0.695	negative regulation of biological process
GO:2000026	0.690	regulation of multicellular organismal development
GO:0006468	0.672	protein phosphorylation
GO:0001934	0.650	positive regulation of protein phosphorylation
GO:0048523	0.560	negative regulation of cellular process
GO:0061035	0.511	regulation of cartilage development
GO:0045935	0.477	positive regulation of nucleobase-containing compound metabolic process
GO:0001822	0.473	kidney development
GO:0045893	0.466	positive regulation of DNA-templated transcription
GO:0001656	0.461	metanephros development
GO:0061036	0.446	positive regulation of cartilage development
GO:0060389	0.409	pathway-restricted SMAD protein phosphorylation
GO:0006357	0.370	regulation of transcription by RNA polymerase II
GO:0009653	0.316	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.926	extracellular space
GO:0005622	0.734	intracellular anatomical structure
GO:0043226	0.546	organelle
GO:0043227	0.504	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]