StarFunc result for job id Q6L8Q7

User Input

>input (609 residues)
MWRLPGARAALRVIRTAVEKLSRAEAGSQTAAGAMERAVVRCVPSEPKLSLSFALADGSH
KNMQRDQSEPLGRVLSRIATNALKGHAKAAAAKKSRKSRPNASGGAACSGPGPEPAVFCE
PVVKLYYREEAVAEDVLNVDAWQDGAVLQIGDVKYKVERNPPAFTELQLPRYIMAGFPVC
PKLSLEFGDPASSLFRWYKEAKPGAAEPEVGVPSSLSPSSPSSSWTETDVEERVYTPSNA
DIGLRLKLHCTPGDGQRFGHSRELESVCVVEAGPGTCTFDHRHLYTKKVTEDALIRTVSY
NILADTYAQTEFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADVICLQEVDRAVFSDS
LVPALEAFGLEGVFRIKQHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEKLVL
YPSAQEKVLQRSSVLQVSVLQSTKDSSKRICVANTHLYWHPKGGYIRLIQMAVALAHIRH
VSCDLYPGIPVIFCGDFNSTPSTGMYHFVINGSIPEDHEDWASNGEEERCNMSLTHFFKL
KSACGEPAYTNYVGGFHGCLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHI
ALVCDLKWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08DF7	0.985	0.985	0.000	609	0.916	0.916	Q08DF7.pdb.gz	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1
2	AFDB:Q3TIU4	0.977	0.978	0.000	608	0.883	0.885	Q3TIU4.pdb.gz	PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus OX=10090 GN=Pde12 PE=1 SV=2
3	AFDB:Q584E4	0.602	0.566	1.482E-45	654	0.258	0.240	Q584E4.pdb.gz	Q584E4_TRYB2 Endonuclease/exonuclease/phosphatase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.840 PE=4 SV=1
4	AFDB:Q8W0Z9	0.478	0.483	1.055E-30	602	0.213	0.216	Q8W0Z9.pdb.gz	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
5	AFDB:O74874	0.457	0.404	1.835E-26	690	0.177	0.157	O74874.pdb.gz	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
6	AFDB:Q9ULM6	0.463	0.505	6.434E-26	557	0.153	0.167	Q9ULM6.pdb.gz	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
7	AFDB:Q8VEG6	0.456	0.499	7.176E-26	555	0.159	0.175	Q8VEG6.pdb.gz	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
8	AFDB:Q9U1P4	0.465	0.462	3.129E-25	613	0.153	0.152	Q9U1P4.pdb.gz	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
9	AFDB:P31384	0.462	0.339	3.490E-25	837	0.146	0.106	P31384.pdb.gz	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
10	AFDB:Q8IMX1	0.459	0.492	6.022E-25	567	0.156	0.168	Q8IMX1.pdb.gz	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
11	PDB:7ax1A	0.449	0.524	3.794E-24	518	0.166	0.195	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
12	PDB:4f1iA	0.308	0.541	9.078E-10	328	0.087	0.162	4f1iA.pdb.gz
13	PDB:4awnA	0.291	0.605	2.671E-8	260	0.074	0.173	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
14	PDB:2a3zB	0.296	0.615	1.230E-7	260	0.069	0.162	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
15	PDB:7kiuA	0.298	0.610	1.616E-7	263	0.076	0.175	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
16	PDB:1akoA	0.259	0.523	5.665E-7	268	0.077	0.175	1akoA.pdb.gz
17	PDB:2imqX	0.260	0.509	9.148E-6	280	0.072	0.157	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
18	PDB:6o1kA	0.264	0.542	1.269E-5	262	0.072	0.168	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
19	PDB:7cd5A	0.262	0.507	5.534E-5	278	0.071	0.155	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
20	PDB:6dlfA	0.125	0.256	1.383E-3	236	0.033	0.085	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08DF7	0.0	1150	609	0.916	0.916	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1
2	Q3TIU4	0.0	1102	608	0.883	0.885	PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus OX=10090 GN=Pde12 PE=1 SV=2
3	Q6L8Q7	0.0	1263	609	1.000	1.000	PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2
4	O74874	5.66e-47	177	690	0.177	0.157	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
5	Q584E4	1.66e-40	159	654	0.213	0.199	Q584E4_TRYB2 Endonuclease/exonuclease/phosphatase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.840 PE=4 SV=1
6	Q8W0Z9	1.04e-33	138	602	0.209	0.211	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
7	Q9ULM6	1.05e-33	137	557	0.167	0.183	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
8	H0Y9Z5	7.40e-33	135	550	0.159	0.176	H0Y9Z5_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
9	Q96LI5	7.69e-33	135	555	0.159	0.175	CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
10	Q8VEG6	1.06e-32	134	555	0.158	0.173	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
11	P31384	1.22e-29	127	837	0.154	0.112	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
12	Q8IMX0	1.44e-29	122	358	0.164	0.279	Q8IMX0_DROME Twin, isoform D OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
13	Q9VCB6	4.03e-29	124	545	0.172	0.193	Q9VCB6_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=2
14	Q7K112	4.88e-29	124	552	0.172	0.190	Q7K112_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
15	Q8IMX1	5.86e-29	123	567	0.172	0.185	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
16	Q8MTZ5	7.25e-29	123	566	0.172	0.186	Q8MTZ5_DROME poly(A)-specific ribonuclease (Fragment) OS=Drosophila melanogaster OX=7227 GN=twin PE=2 SV=1
17	Q9U1P4	4.96e-27	118	613	0.154	0.153	Q9U1P4_CAEEL poly(A)-specific ribonuclease OS=Caenorhabditis elegans OX=6239 GN=ccr-4 PE=1 SV=2
18	H0Y9C1	1.02e-24	109	435	0.110	0.154	H0Y9C1_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
19	A8MS41	1.17e-24	108	417	0.146	0.213	CCR4D_ARATH Carbon catabolite repressor protein 4 homolog 4 OS=Arabidopsis thaliana OX=3702 GN=CCR4-4 PE=1 SV=1
20	Q9UK39	3.66e-24	107	431	0.164	0.232	NOCT_HUMAN Nocturnin OS=Homo sapiens OX=9606 GN=NOCT PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15893 DUF4739	4e+02	12.0	Domain of unknown function (DUF4739)
2	PF17424 DUF5411	7e+02	11.5	Family of unknown function (DUF5411)
3	PF03372 Exo_endo_phos	1.1e-16	72.8	Endonuclease/Exonuclease/phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309142

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356530	0.965	2-5A-dependent ribonuclease
2	9606.ENSP00000358866	0.900	Filamin-A
3	9606.ENSP00000320949	0.794	CCR4-NOT transcription complex subunit 1
4	9606.ENSP00000276590	0.778	Endoribonuclease LACTB2
5	9606.ENSP00000450909	0.760	SRA stem-loop-interacting RNA-binding protein, mitochondrial
6	9606.ENSP00000263063	0.756	Poly(A) RNA polymerase, mitochondrial
7	9606.ENSP00000229195	0.748	CCR4-NOT transcription complex subunit 2
8	9606.ENSP00000273064	0.745	CCR4-NOT transcription complex subunit 9
9	9606.ENSP00000355279	0.733	CCR4-NOT transcription complex subunit 7
10	9606.ENSP00000260665	0.726	Leucine-rich PPR motif-containing protein, mitochondrial
11	9606.ENSP00000445508	0.725	CCR4-NOT transcription complex subunit 4
12	9606.ENSP00000430493	0.721	CCR4-NOT transcription complex subunit 8
13	9606.ENSP00000377814	0.716	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
14	9606.ENSP00000352678	0.701	ATP-dependent RNA helicase SUPV3L1, mitochondrial
15	9606.ENSP00000351159	0.686	CCR4-NOT transcription complex subunit 3
16	9606.ENSP00000400646	0.685	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
17	9606.ENSP00000231198	0.649	Probable tRNA(His) guanylyltransferase
18	9606.ENSP00000251607	0.634	CCA tRNA nucleotidyltransferase 1, mitochondrial
19	9606.ENSP00000287675	0.631	Nuclease EXOG, mitochondrial
20	9606.ENSP00000405252	0.606	A-kinase anchor protein 7 isoform gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004527	1.000	exonuclease activity
GO:0004540	1.000	ribonuclease activity
GO:0000175	0.928	3'-5'-RNA exonuclease activity
GO:0005488	0.886	binding
GO:0005515	0.531	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0010605	0.991	negative regulation of macromolecule metabolic process
GO:0031325	0.991	positive regulation of cellular metabolic process
GO:0010604	0.990	positive regulation of macromolecule metabolic process
GO:0031324	0.990	negative regulation of cellular metabolic process
GO:0051173	0.989	positive regulation of nitrogen compound metabolic process
GO:0043487	0.989	regulation of RNA stability
GO:0044260	0.988	cellular macromolecule metabolic process
GO:0061013	0.988	regulation of mRNA catabolic process
GO:0090304	0.985	nucleic acid metabolic process
GO:0051246	0.983	regulation of protein metabolic process
GO:0016071	0.982	mRNA metabolic process
GO:0051172	0.981	negative regulation of nitrogen compound metabolic process
GO:0061014	0.978	positive regulation of mRNA catabolic process
GO:0043488	0.977	regulation of mRNA stability
GO:0034655	0.976	nucleobase-containing compound catabolic process
GO:2000112	0.975	regulation of cellular macromolecule biosynthetic process
GO:0006417	0.973	regulation of translation
GO:0006401	0.971	RNA catabolic process
GO:2000113	0.969	negative regulation of cellular macromolecule biosynthetic process
GO:0051248	0.967	negative regulation of protein metabolic process
GO:0010629	0.966	negative regulation of gene expression
GO:0017148	0.962	negative regulation of translation
GO:0050779	0.948	RNA destabilization
GO:0006402	0.944	mRNA catabolic process
GO:0061157	0.933	mRNA destabilization
GO:0000956	0.805	nuclear-transcribed mRNA catabolic process
GO:0050896	0.552	response to stimulus
GO:0090305	0.450	nucleic acid phosphodiester bond hydrolysis
GO:0000288	0.366	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0051716	0.350	cellular response to stimulus
GO:0010467	0.348	gene expression
GO:0006950	0.327	response to stress
GO:1901699	0.302	cellular response to nitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005829	0.992	cytosol
GO:0005759	0.968	mitochondrial matrix
GO:0032991	0.374	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.
EC:3.1.13.-	0.928	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]