StarFunc result for job id Q6L9T8

User Input

>input (149 residues)
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGV
NVLLRGNLPEIEESTDEDVLNISAEECIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0Y354	0.965	0.965	3.473E-26	149	0.993	0.993	H0Y354.pdb.gz	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
2	AFDB:A1KXW8	0.865	0.865	1.794E-23	149	0.879	0.879	A1KXW8.pdb.gz	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
3	AFDB:A0A087WSW5	0.420	0.644	7.364E-10	94	0.510	0.809	A0A087WSW5.pdb.gz	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
4	AFDB:Q9CZJ6	0.474	0.360	4.440E-4	204	0.154	0.113	Q9CZJ6.pdb.gz	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
5	AFDB:Q9P802	0.509	0.401	5.517E-4	194	0.134	0.103	Q9P802.pdb.gz	MIS18_SCHPO Kinetochore protein mis18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis18 PE=1 SV=2
6	AFDB:Q9NYP9	0.492	0.328	1.246E-3	233	0.121	0.077	Q9NYP9.pdb.gz	MS18A_HUMAN Protein Mis18-alpha OS=Homo sapiens OX=9606 GN=MIS18A PE=1 SV=1
7	PDB:6h0gB	0.460	0.196	2.352E-3	401	0.107	0.040	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
8	AFDB:P62699	0.481	0.579	3.499E-3	121	0.067	0.083	P62699.pdb.gz	YPEL5_HUMAN Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1
9	AFDB:Q2V3E2	0.455	0.622	3.694E-3	105	0.094	0.133	Q2V3E2.pdb.gz	YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana OX=3702 GN=At4g27740 PE=3 SV=1
10	AFDB:A2AQ14	0.482	0.314	3.900E-3	241	0.134	0.083	A2AQ14.pdb.gz	MS18B_MOUSE Protein Mis18-beta OS=Mus musculus OX=10090 GN=Oip5 PE=2 SV=1
11	AFDB:Q9XZF0	0.463	0.554	4.118E-3	121	0.087	0.107	Q9XZF0.pdb.gz	YIPP_DROME Protein yippee OS=Drosophila melanogaster OX=7227 GN=Ype PE=1 SV=1
12	PDB:5fqdE	0.435	0.195	9.659E-3	367	0.107	0.044	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
13	PDB:2kv1A	0.382	0.443	2.304E-2	124	0.161	0.194	2kv1A.pdb.gz
14	PDB:6h61A	0.378	0.102	5.801E-2	660	0.101	0.023	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
15	PDB:6symA	0.356	0.383	2.655E-1	135	0.094	0.104	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
16	PDB:5yzgY	0.143	0.109	5.998E-1	204	0.067	0.049	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:6j6qF	0.137	0.128	6.686E-1	161	0.067	0.062	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:1x0tA	0.163	0.216	1.355	106	0.074	0.104	1x0tA.pdb.gz	Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
19	PDB:6bk8D	0.137	0.076	1.684	359	0.040	0.017	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	PDB:7lhdB	0.172	0.187	1.778	132	0.087	0.098	7lhdB.pdb.gz	Structural Assembly of Q beta Virion and Its Diverse Forms of Virus-like Particles.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6L9T8	4.44e-108	305	149	1.000	1.000	FA72D_HUMAN Protein FAM72D OS=Homo sapiens OX=9606 GN=FAM72D PE=1 SV=1
2	H0Y354	1.08e-106	302	149	0.993	0.993	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
3	Q5TYM5	8.71e-106	300	149	0.987	0.987	FA72A_HUMAN Protein FAM72A OS=Homo sapiens OX=9606 GN=FAM72A PE=1 SV=1
4	Q86X60	3.93e-104	295	149	0.973	0.973	FA72B_HUMAN Protein FAM72B OS=Homo sapiens OX=9606 GN=FAM72B PE=1 SV=2
5	A1KXW8	1.32e-92	266	149	0.879	0.879	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
6	A0A087WSW5	8.05e-49	154	94	0.510	0.809	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
7	A0A087WZP4	1.14e-48	153	94	0.510	0.809	A0A087WZP4_HUMAN Family with sequence similarity 72 member B OS=Homo sapiens OX=9606 GN=FAM72B PE=3 SV=1
8	Q8IAM0	1.6	31.2	1397	0.107	0.011	Q8IAM0_PLAF7 Glutamate dehydrogenase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802000 PE=3 SV=1
9	Q57984	3.7	30.0	892	0.141	0.024	SYA_METJA Alanine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=alaS PE=1 SV=1
10	Q1ECF1	6.7	28.9	211	0.101	0.071	PYL7_ARATH Abscisic acid receptor PYL7 OS=Arabidopsis thaliana OX=3702 GN=PYL7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14976 FAM72	1.4e-71	250.8	FAM72 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477695	0.559	Ankyrin repeat domain-containing protein 20A1
2	9606.ENSP00000349891	0.556	Ankyrin repeat domain-containing protein 20A4
3	9606.ENSP00000358813	0.540	Dual specificity protein kinase TTK
4	9606.ENSP00000481934	0.523	Rho GTPase-activating protein 11B
5	9606.ENSP00000366826	0.520	Ankyrin repeat domain-containing protein 20A2
6	9606.ENSP00000366608	0.517	COBW domain-containing protein 6
7	9606.ENSP00000478290	0.512	SLIT-ROBO Rho GTPase-activating protein 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048523	0.960	negative regulation of cellular process
GO:0051171	0.955	regulation of nitrogen compound metabolic process
GO:0080090	0.954	regulation of primary metabolic process
GO:0048518	0.950	positive regulation of biological process
GO:0048522	0.943	positive regulation of cellular process
GO:0060255	0.900	regulation of macromolecule metabolic process
GO:0051338	0.867	regulation of transferase activity
GO:0031399	0.847	regulation of protein modification process
GO:0009966	0.838	regulation of signal transduction
GO:0010605	0.818	negative regulation of macromolecule metabolic process
GO:0051172	0.817	negative regulation of nitrogen compound metabolic process
GO:0031323	0.813	regulation of cellular metabolic process
GO:0044092	0.796	negative regulation of molecular function
GO:0051348	0.781	negative regulation of transferase activity
GO:0031400	0.777	negative regulation of protein modification process
GO:0001932	0.754	regulation of protein phosphorylation
GO:0045859	0.731	regulation of protein kinase activity
GO:0009987	0.713	cellular process
GO:0010469	0.710	regulation of signaling receptor activity
GO:0061097	0.710	regulation of protein tyrosine kinase activity
GO:0050732	0.710	negative regulation of peptidyl-tyrosine phosphorylation
GO:0006469	0.707	negative regulation of protein kinase activity
GO:0010941	0.702	regulation of cell death
GO:0043067	0.634	regulation of programmed cell death
GO:0010942	0.624	positive regulation of cell death
GO:0042981	0.619	regulation of apoptotic process
GO:0043068	0.597	positive regulation of programmed cell death
GO:0043065	0.594	positive regulation of apoptotic process
GO:0023057	0.564	negative regulation of signaling
GO:0010648	0.527	negative regulation of cell communication
GO:0009968	0.516	negative regulation of signal transduction
GO:0016043	0.326	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0043232	0.521	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]