StarFunc result for job id Q6MZP7

User Input

>input (749 residues)
MEVVPAEVNSLLPEEIMDTGITLVDDDSIEAVIVSSPIPMETELEEIVNINSTGDSTATP
ISTEPITVYSNHTNQVAVNTTITKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKV
SQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTTQAQSGDAKLPP
QQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGP
VITKLIFAKPINSKAVTGQTTQVSPPVIAGRVLSQSTPGTPSKTITISESGVIGSTLNST
TQTPNKIAISPLKSPNKAVKSTVQTITVGGVSTSQFKTIIPLATAPNVQQIQVPGSKFHY
VRLVTATSASSSTQPVSQNPSTNTQPLQQAKPVVVNTTPVRMSVPIVSAQAVKQVVPKPI
NPTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQ
LQQSSYVSIASNSTFTGTSGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCF
ANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCN
CKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKT
KLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER
MILEEFGRCLMSVINSAGKAKSDPCAMNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6MZP7	1.000	1.000	7.441E-101	749	1.000	1.000	Q6MZP7.pdb.gz	LIN54_HUMAN Protein lin-54 homolog OS=Homo sapiens OX=9606 GN=LIN54 PE=1 SV=3
2	AFDB:P34333	0.054	0.025	6.079E-3	1778	0.162	0.068	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
3	AFDB:Q3UHX0	0.051	0.035	1.639E-1	1147	0.117	0.077	Q3UHX0.pdb.gz	NOL8_MOUSE Nucleolar protein 8 OS=Mus musculus OX=10090 GN=Nol8 PE=1 SV=2
4	AFDB:Q9C0I3	0.061	0.053	6.847E-1	900	0.156	0.130	Q9C0I3.pdb.gz	CCSE1_HUMAN Serine-rich coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCSER1 PE=1 SV=2
5	AFDB:S4R3N7	0.070	0.067	7.286E-1	796	0.131	0.123	S4R3N7.pdb.gz	S4R3N7_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=3
6	PDB:4h54A	0.064	0.138	7.456E-1	274	0.021	0.058	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
7	PDB:7aqqf	0.068	0.361	1.083	101	0.015	0.109	7aqqf.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
8	PDB:7td5A	0.048	0.068	1.388	497	0.033	0.050	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
9	AFDB:P16014	0.046	0.050	1.444	677	0.120	0.133	P16014.pdb.gz	SCG1_MOUSE Secretogranin-1 OS=Mus musculus OX=10090 GN=Chgb PE=1 SV=2
10	PDB:5hynA	0.050	0.061	1.477	581	0.037	0.048	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
11	PDB:7nacR	0.053	0.238	1.673	134	0.019	0.104	7nacR.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	AFDB:Q0VDD7	0.070	0.075	1.851	668	0.136	0.153	Q0VDD7.pdb.gz	BRME1_HUMAN Break repair meiotic recombinase recruitment factor 1 OS=Homo sapiens OX=9606 GN=BRME1 PE=1 SV=2
13	AFDB:A0A024QZY5	0.065	0.051	2.231	1007	0.105	0.078	A0A024QZY5.pdb.gz
14	AFDB:F8W2W1	0.056	0.042	2.374	1078	0.123	0.085	F8W2W1.pdb.gz
15	PDB:7td5F	0.048	0.074	2.585	447	0.031	0.051	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
16	AFDB:Q24167	0.055	0.029	2.688	1507	0.128	0.064	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
17	PDB:7w59U	0.053	0.353	2.750	72	0.011	0.111	7w59U.pdb.gz	Mechanism of exon ligation by human spliceosome.
18	PDB:3aohI	0.075	0.045	3.115	1289	0.020	0.012	3aohI.pdb.gz	Crystal structure of bacterial RNA polymerase bound with a transcription inhibitor protein
19	PDB:2h9dA	0.052	0.333	3.314	84	0.017	0.155	2h9dA.pdb.gz	Two Crystal Structures of the Isochorismate Pyruvate Lyase from Pseudomonas aeruginosa.
20	PDB:7azyH	0.059	0.179	3.527	188	0.020	0.080	7azyH.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6MZP7	0.0	1504	749	1.000	1.000	LIN54_HUMAN Protein lin-54 homolog OS=Homo sapiens OX=9606 GN=LIN54 PE=1 SV=3
2	Q9WTJ6	1.34e-70	241	475	0.162	0.255	MTL5_MOUSE Tesmin OS=Mus musculus OX=10090 GN=Tesmin PE=1 SV=2
3	Q9Y4I5	5.77e-62	218	508	0.162	0.238	MTL5_HUMAN Tesmin OS=Homo sapiens OX=9606 GN=TESMIN PE=1 SV=2
4	Q95QD7	9.80e-62	215	435	0.143	0.246	LIN54_CAEEL Protein lin-54 OS=Caenorhabditis elegans OX=6239 GN=lin-54 PE=1 SV=1
5	A1Z9E2	5.83e-61	223	950	0.142	0.112	LIN54_DROME Protein lin-54 homolog OS=Drosophila melanogaster OX=7227 GN=mip120 PE=1 SV=1
6	F4JY84	4.20e-48	178	459	0.109	0.179	TCX7_ARATH Protein tesmin/TSO1-like CXC 7 OS=Arabidopsis thaliana OX=3702 GN=TCX7 PE=1 SV=1
7	Q9SZD1	5.65e-47	178	603	0.108	0.134	TCX5_ARATH Protein tesmin/TSO1-like CXC 5 OS=Arabidopsis thaliana OX=3702 GN=TCX5 PE=1 SV=1
8	Q9SL70	9.94e-45	171	571	0.101	0.133	TCX6_ARATH Protein tesmin/TSO1-like CXC 6 OS=Arabidopsis thaliana OX=3702 GN=TCX6 PE=1 SV=1
9	Q700D0	4.01e-28	119	368	0.079	0.160	TCX8_ARATH Protein tesmin/TSO1-like CXC 8 OS=Arabidopsis thaliana OX=3702 GN=TCX8 PE=1 SV=1
10	Q8L548	9.10e-27	118	609	0.081	0.100	TCX3_ARATH Protein tesmin/TSO1-like CXC 3 OS=Arabidopsis thaliana OX=3702 GN=TCX3 PE=1 SV=1
11	F4JIF5	5.72e-26	116	674	0.075	0.083	TCX2_ARATH Protein tesmin/TSO1-like CXC 2 OS=Arabidopsis thaliana OX=3702 GN=TCX2 PE=1 SV=1
12	Q9LUI3	1.95e-25	114	695	0.073	0.079	TSO1_ARATH CRC domain-containing protein TSO1 OS=Arabidopsis thaliana OX=3702 GN=TSO1 PE=1 SV=1
13	Q84JZ8	2.59e-25	114	639	0.073	0.086	TCX4_ARATH Protein tesmin/TSO1-like CXC 4 OS=Arabidopsis thaliana OX=3702 GN=TCX4 PE=1 SV=1
14	Q9VMQ3	2.97e-08	57.4	243	0.025	0.078	Q9VMQ3_DROME RT06796p1 OS=Drosophila melanogaster OX=7227 GN=tomb PE=2 SV=1
15	O17514	1.1	35.0	773	0.023	0.022	MES2_CAEEL Histone-lysine N-methyltransferase mes-2 OS=Caenorhabditis elegans OX=6239 GN=mes-2 PE=1 SV=2
16	Q8NA54	1.7	34.7	791	0.043	0.040	IQUB_HUMAN IQ and ubiquitin-like domain-containing protein OS=Homo sapiens OX=9606 GN=IQUB PE=1 SV=2
17	Q9ZSM8	2.1	34.3	856	0.021	0.019	EZA1_ARATH Histone-lysine N-methyltransferase EZA1 OS=Arabidopsis thaliana OX=3702 GN=EZA1 PE=1 SV=1
18	A0A0B4KH73	3.3	33.9	1471	0.019	0.010	A0A0B4KH73_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7029 PE=4 SV=1
19	A0A0B4KHX6	3.9	33.5	1506	0.019	0.009	A0A0B4KHX6_DROME Uncharacterized protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7029 PE=4 SV=1
20	A8JR84	3.9	33.5	1517	0.019	0.009	A8JR84_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7029 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16682 MSL2-CXC	1.8e+02	13.7	CXC domain of E3 ubiquitin-protein ligase MSL2
2	PF03638 TCR	9.5e-18	75.5	Tesmin/TSO1-like CXC domain, cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010357248.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380293.1	0.999	Lin-9 DREAM MuvB core complex component
2	61622.XP_010367569.1	0.998	Lin-37 DREAM MuvB core complex component
3	61622.XP_010352478.1	0.997	RB binding protein 4, chromatin remodeling factor
4	61622.XP_010382608.1	0.995	MYB proto-oncogene like 2
5	61622.XP_010380929.1	0.994	Lin-52 DREAM MuvB core complex component
6	61622.XP_010367558.1	0.980	RB binding protein 7, chromatin remodeling factor
7	61622.XP_010353624.1	0.973	RB transcriptional corepressor like 1
8	61622.XP_010356527.1	0.969	RB transcriptional corepressor like 2
9	61622.XP_010369884.1	0.955	Myb-related protein A isoform X1
10	61622.XP_010368966.1	0.945	MYB proto-oncogene, transcription factor
11	61622.XP_010353430.1	0.929	Transcription factor E2F4
12	61622.XP_010357486.1	0.922	Forkhead box protein M1 isoform X1
13	61622.XP_010380048.1	0.910	Transcription factor E2F5 isoform X1
14	61622.XP_010362160.1	0.896	RB transcriptional corepressor 1
15	61622.XP_010368297.1	0.870	DDB1 and CUL4 associated factor 10
16	61622.XP_010381265.1	0.855	WD repeat-containing protein 59 isoform X1
17	61622.XP_010368171.1	0.854	WD repeat-containing protein 73 isoform X1
18	61622.XP_010373133.1	0.844	Transcription factor Dp-1 isoform X1
19	61622.XP_010376576.1	0.844	Transcription factor Dp-2
20	61622.XP_010387729.1	0.844	Transcription factor Dp family member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001067	1.000	transcription regulatory region nucleic acid binding
GO:0003680	1.000	minor groove of adenine-thymine-rich DNA binding
GO:0003690	0.332	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0043933	0.950	protein-containing complex organization
GO:0006325	0.942	chromatin organization
GO:0071824	0.933	protein-DNA complex subunit organization
GO:0006338	0.913	chromatin remodeling
GO:0034728	0.817	nucleosome organization
GO:0050789	0.724	regulation of biological process
GO:0050794	0.711	regulation of cellular process
GO:0019222	0.656	regulation of metabolic process
GO:0060255	0.590	regulation of macromolecule metabolic process
GO:0031323	0.589	regulation of cellular metabolic process
GO:0080090	0.588	regulation of primary metabolic process
GO:0051171	0.588	regulation of nitrogen compound metabolic process
GO:0019219	0.410	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.407	positive regulation of biological process
GO:0048522	0.384	positive regulation of cellular process
GO:0010468	0.376	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.997	nuclear protein-containing complex
GO:0005667	0.995	transcription regulator complex
GO:0090571	0.994	RNA polymerase II transcription repressor complex
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0005694	0.651	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]