StarFunc result for job id Q6MZQ0

User Input

>input (368 residues)
MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAV
INVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGEN
RIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQ
SKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGISGDRSFSGPTYTLARR
HSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ
LLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLEEGARGSQEGS
ELNCASLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AVJ5	0.791	0.787	1.736E-41	370	0.916	0.911	A2AVJ5.pdb.gz	PRR5L_MOUSE Proline-rich protein 5-like OS=Mus musculus OX=10090 GN=Prr5l PE=1 SV=1
2	AFDB:D3ZAX5	0.092	0.049	3.879E-3	935	0.179	0.071	D3ZAX5.pdb.gz	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
3	AFDB:O59751	0.105	0.055	5.570E-2	784	0.158	0.074	O59751.pdb.gz	KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp6 PE=1 SV=1
4	AFDB:Q55BD8	0.136	0.077	7.065E-2	899	0.179	0.073	Q55BD8.pdb.gz	Q55BD8_DICDI CLIP-associating protein OS=Dictyostelium discoideum OX=44689 GN=clasp PE=4 SV=1
5	PDB:6v9iC	0.325	0.181	8.074E-2	730	0.057	0.029	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
6	AFDB:O94387	0.141	0.039	9.399E-2	1944	0.133	0.025	O94387.pdb.gz	YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.10c PE=3 SV=1
7	AFDB:Q7TPV4	0.128	0.055	1.375E-1	1344	0.128	0.035	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
8	AFDB:G5EFJ4	0.128	0.062	1.513E-1	1153	0.133	0.042	G5EFJ4.pdb.gz	CAPG1_CAEEL Condensin complex subunit capg-1 OS=Caenorhabditis elegans OX=6239 GN=capg-1 PE=1 SV=1
9	AFDB:Q9NFR7	0.136	0.095	1.745E-1	658	0.122	0.068	Q9NFR7.pdb.gz	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
10	AFDB:Q6ZQK0	0.139	0.049	2.110E-1	1506	0.114	0.028	Q6ZQK0.pdb.gz	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
11	PDB:7qe7N	0.215	0.130	2.193E-1	682	0.062	0.034	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	AFDB:Q7SYD5	0.092	0.048	2.321E-1	1254	0.147	0.043	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
13	PDB:7kzpG	0.121	0.087	3.059E-1	577	0.090	0.057	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
14	PDB:5ex0A	0.179	0.159	4.476E-1	429	0.062	0.054	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
15	PDB:3axjA	0.161	0.226	5.415E-1	225	0.073	0.120	3axjA.pdb.gz
16	PDB:3ik7A	0.154	0.230	5.679E-1	221	0.073	0.122	3ik7A.pdb.gz	Substrate specificity combined with stereopromiscuity in glutathione transferase A4-4-dependent metabolism of 4-hydroxynonenal.
17	PDB:7dkhI	0.119	0.060	5.955E-1	914	0.084	0.034	7dkhI.pdb.gz
18	PDB:7f66J	0.201	0.140	6.550E-1	591	0.054	0.034	7f66J.pdb.gz
19	PDB:6ww7B	0.120	0.147	8.309E-1	281	0.057	0.075	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
20	PDB:3q15A	0.118	0.119	8.714E-1	365	0.065	0.066	3q15A.pdb.gz	Structural basis of response regulator dephosphorylation by Rap phosphatases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AVJ5	0.0	659	370	0.916	0.911	PRR5L_MOUSE Proline-rich protein 5-like OS=Mus musculus OX=10090 GN=Prr5l PE=1 SV=1
2	Q6MZQ0	0.0	750	368	1.000	1.000	PRR5L_HUMAN Proline-rich protein 5-like OS=Homo sapiens OX=9606 GN=PRR5L PE=1 SV=2
3	P85299	7.05e-74	236	388	0.353	0.335	PRR5_HUMAN Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5 PE=1 SV=1
4	Q812A5	1.22e-72	233	387	0.342	0.326	PRR5_MOUSE Proline-rich protein 5 OS=Mus musculus OX=10090 GN=Prr5 PE=1 SV=2
5	B1AHC3	1.11e-19	92.8	564	0.128	0.083	B1AHC3_HUMAN PRR5-ARHGAP8 readthrough OS=Homo sapiens OX=9606 GN=PRR5-ARHGAP8 PE=1 SV=1
6	O74547	0.060	37.7	422	0.109	0.095	BIT61_SCHPO Target of rapamycin complex 2 subunit bit61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bit61 PE=1 SV=1
7	A7BHQ9	1.3	33.5	625	0.144	0.085	TYRO_PHONA Tyrosinase OS=Pholiota nameko OX=61267 GN=tyr1 PE=1 SV=1
8	O14208	2.1	32.7	302	0.038	0.046	YDT3_SCHPO Uncharacterized protein C6B12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6B12.03c PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08539 HbrB	2.1e-09	49.1	HbrB-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368144

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296782	0.996	Rapamycin-insensitive companion of mTOR
2	9606.ENSP00000354558	0.981	Serine/threonine-protein kinase mTOR
3	9606.ENSP00000456405	0.972	Target of rapamycin complex subunit LST8
4	9606.ENSP00000307272	0.949	Regulatory-associated protein of mTOR
5	9606.ENSP00000265960	0.930	Target of rapamycin complex 2 subunit MAPKAP1
6	9606.ENSP00000384848	0.912	Proline-rich protein 5
7	9606.ENSP00000262319	0.900	Telomere length regulation protein TEL2 homolog
8	9606.ENSP00000362547	0.900	TELO2-interacting protein 1 homolog
9	9606.ENSP00000379290	0.676	Breast carcinoma amplified sequence 1
10	9606.ENSP00000286234	0.672	DEP domain-containing mTOR-interacting protein
11	9606.ENSP00000322218	0.670	Membrane-associated phosphatidylinositol transfer protein 2
12	9606.ENSP00000374424	0.639	Rho GTPase activating protein 8
13	9606.ENSP00000429240	0.639	annotation not available
14	9606.ENSP00000379696	0.609	cAMP-dependent protein kinase inhibitor alpha
15	9606.ENSP00000469647	0.598	mRNA decay activator protein ZFP36
16	9606.ENSP00000338228	0.556	Uncharacterized protein C5orf56
17	9606.ENSP00000375711	0.512	Proline-rich AKT1 substrate 1
18	9606.ENSP00000384621	0.500	ATP-dependent RNA helicase DQX1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	1.000	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0031929	0.981	TOR signaling
GO:0051246	0.980	regulation of protein metabolic process
GO:0051174	0.979	regulation of phosphorus metabolic process
GO:0048522	0.978	positive regulation of cellular process
GO:0030334	0.978	regulation of cell migration
GO:0008152	0.970	metabolic process
GO:0010762	0.970	regulation of fibroblast migration
GO:0009893	0.969	positive regulation of metabolic process
GO:0031399	0.964	regulation of protein modification process
GO:0019220	0.950	regulation of phosphate metabolic process
GO:0031325	0.946	positive regulation of cellular metabolic process
GO:0051173	0.942	positive regulation of nitrogen compound metabolic process
GO:0001932	0.942	regulation of protein phosphorylation
GO:0010604	0.939	positive regulation of macromolecule metabolic process
GO:0044237	0.933	cellular metabolic process
GO:0006793	0.908	phosphorus metabolic process
GO:0048583	0.907	regulation of response to stimulus
GO:0006796	0.901	phosphate-containing compound metabolic process
GO:0023051	0.877	regulation of signaling
GO:0010646	0.877	regulation of cell communication
GO:0016310	0.877	phosphorylation
GO:1902531	0.857	regulation of intracellular signal transduction
GO:0051247	0.833	positive regulation of protein metabolic process
GO:0071704	0.799	organic substance metabolic process
GO:0044238	0.761	primary metabolic process
GO:1902533	0.740	positive regulation of intracellular signal transduction
GO:0048519	0.696	negative regulation of biological process
GO:0048523	0.643	negative regulation of cellular process
GO:0006807	0.620	nitrogen compound metabolic process
GO:0043170	0.533	macromolecule metabolic process
GO:0031401	0.517	positive regulation of protein modification process
GO:1901564	0.504	organonitrogen compound metabolic process
GO:0031324	0.422	negative regulation of cellular metabolic process
GO:0042327	0.379	positive regulation of phosphorylation
GO:0001934	0.368	positive regulation of protein phosphorylation
GO:0070887	0.346	cellular response to chemical stimulus
GO:0051248	0.337	negative regulation of protein metabolic process
GO:0045936	0.334	negative regulation of phosphate metabolic process
GO:0031400	0.329	negative regulation of protein modification process
GO:0031329	0.312	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0140535	0.996	intracellular protein-containing complex
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0031932	0.990	TORC2 complex
GO:0005829	0.916	cytosol
GO:0005739	0.785	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]